PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5926848 to PF05057 (DUF676)

VIMSS5926848 has 364 amino acids

Query:       DUF676  [M=219]
Accession:   PF05057.14
Description: Putative serine esterase (DUF676)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.9e-11   30.0   0.0    3.1e-11   29.3   0.0    1.2  1  VIMSS5926848  


Domain annotation for each sequence (and alignments):
>> VIMSS5926848  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   29.3   0.0   3.1e-11   3.1e-11       8     102 ..      55     146 ..      53     173 .. 0.84

  Alignments for each domain:
  == domain 1  score: 29.3 bits;  conditional E-value: 3.1e-11
        DUF676   8 vVlvHGlqgnsaDlelikeqlekikeklpeekieflmsennesktfkgidvlgerlaeevlevvkkkkdknkkiSfvghSlGgliaraaiaklke 102
                   ++lvHGl g     + + ++++ i+e+l+++   +   + +  ++ +g +  ge+l+ +v  v+ +   +  k+ +vghS+Ggl++r++ a++ +
  VIMSS5926848  55 IILVHGLTGTD-KYAGVLDYWYGIQEDLQQHGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGAT--KVNLVGHSQGGLTSRYVAAVAPD 146
                   79*******75.46778899***********99999999999*********************9999998..****************9886663 PP



Or compare VIMSS5926848 to CDD or PaperBLAST