PaperBLAST – Find papers about a protein or its homologs

 

Align WP_006094994.1 to PF05057 (DUF676)

WP_006094994.1 has 413 amino acids

Query:       DUF676  [M=219]
Accession:   PF05057.14
Description: Putative serine esterase (DUF676)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    8.6e-10   24.6   0.2    1.4e-08   20.6   0.0    2.6  3  WP_006094994.1  


Domain annotation for each sequence (and alignments):
>> WP_006094994.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.1   0.0     0.027     0.027       8      23 ..      36      51 ..      30      74 .. 0.74
   2 !   20.6   0.0   1.4e-08   1.4e-08      71     135 ..     123     200 ..     112     226 .. 0.77
   3 ?   -1.1   0.0     0.062     0.062     139     190 ..     238     288 ..     234     293 .. 0.84

  Alignments for each domain:
  == domain 1  score: 0.1 bits;  conditional E-value: 0.027
          DUF676  8 vVlvHGlqgnsaDlel 23
                    ++lvHG+ g + D  l
  WP_006094994.1 36 IILVHGFTGWGRDELL 51
                    89*****998777555 PP

  == domain 2  score: 20.6 bits;  conditional E-value: 1.4e-08
          DUF676  71 vkkkkdknkkiSfvghSlGgliaraaiaklkekem............tlkeaikg..lepvtfitlasPhLGvlyssks 135
                     +++ +++ +k+ +vghS+Gg ++r  +  lke ++            +++ +++g   +++  +tla+Ph G+     s
  WP_006094994.1 123 IRNWSET-NKVHLVGHSMGGQTIRTLVQILKEGNQeerdyakqhvdvKVSPLFQGgkSYVHSVTTLATPHNGTTLADGS 200
                     5566666.6*******************99988878888877665542455666422678999*******999877666 PP

  == domain 3  score: -1.1 bits;  conditional E-value: 0.062
          DUF676 139 lglalleklkkslsmeqlgltGrdLflkddkdeknsllykllkdekdlklie 190
                      g +++++ + +l+  +l+ t +d++  d + +  + l   +k ++d+ +++
  WP_006094994.1 238 AGESFYQYSNRVLNSSILKDT-KDISQWDLSTDGAKELNDWVKAQPDVYYFS 288
                     577899999999999999999.999999999999998888888888887776 PP



Or compare WP_006094994.1 to CDD or PaperBLAST