PaperBLAST – Find papers about a protein or its homologs

 

Align XP_649190.1 to PF05057 (DUF676)

XP_649190.1 has 399 amino acids

Query:       DUF676  [M=219]
Accession:   PF05057.14
Description: Putative serine esterase (DUF676)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.6e-10   27.0   0.1    4.2e-10   25.6   0.0    1.7  2  XP_649190.1  


Domain annotation for each sequence (and alignments):
>> XP_649190.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   25.6   0.0   4.2e-10   4.2e-10      71     149 ..     169     243 ..     159     307 .. 0.70
   2 ?   -2.3   0.0      0.14      0.14      35      73 ..     357     395 ..     345     397 .. 0.72

  Alignments for each domain:
  == domain 1  score: 25.6 bits;  conditional E-value: 4.2e-10
       DUF676  71 vkkkkdknkkiSfvghSlGgliaraaiaklkekemtlkeaikglepvtfitlasPhLGvlyssksli....nlglalleklkk 149
                  +k+++++ +k+ +v hS+Ggl+  + + kl        +++++ +++ ++++++P++G+   + + +    n+g ++ + l k
  XP_649190.1 169 IKAYENTGNKVVLVSHSMGGLTTYILLDKLG-------KEFCDKYIHRWVAMSTPFIGTTIANDV-VlagyNMGYPVSKELIK 243
                  5666777679************998888777.......357788*****************9998.50222455555555544 PP

  == domain 2  score: -2.3 bits;  conditional E-value: 0.14
       DUF676  35 lpeekieflmsennesktfkgidvlgerlaeevlevvkk 73 
                  +  + +e++ ++  +    +  +  g  l +ev+e+vk+
  XP_649190.1 357 VTLNSLEYCKKMTENFTNLGKYTHQGMLLKKEVIEYVKN 395
                  555567777777777777777777888888999999886 PP



Or compare XP_649190.1 to CDD or PaperBLAST