PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::A0A0H3CC29 to PF05114 (DUF692)

SwissProt::A0A0H3CC29 has 280 amino acids

Query:       DUF692  [M=263]
Accession:   PF05114.13
Description: Protein of unknown function (DUF692)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence              Description
    ------- ------ -----    ------- ------ -----   ---- --  --------              -----------
   4.6e-113  362.8   0.0   5.2e-113  362.7   0.0    1.0  1  SwissProt::A0A0H3CC29  


Domain annotation for each sequence (and alignments):
>> SwissProt::A0A0H3CC29  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  362.7   0.0  5.2e-113  5.2e-113       1     260 [.       8     268 ..       8     271 .. 0.98

  Alignments for each domain:
  == domain 1  score: 362.7 bits;  conditional E-value: 5.2e-113
                 DUF692   1 gvGlglrrelleelleekpe.vdflEvaaenylkaggkarkelealreryplvlHGvslslGsaepldeehlkrlkallerlepalvS 87 
                            g+Glglr+++++++l+++++ vdf+Ev++en++  gg++ ++++a+reryp++lHGvs+s+Gsa++++ ++l+rlk l++r++p +vS
  SwissProt::A0A0H3CC29   8 GFGLGLRPPHYRAFLDSERPlVDFVEVISENFMVGGGRPLHVIDAVRERYPVALHGVSMSVGSADGVKLDYLRRLKGLADRVDPMWVS 95 
                            58*************866667******************************************************************* PP

                 DUF692  88 eHlsfssaggvelndllPlpyteealavvaerikqvqdiLerplllEnvssylafpeselsEaeFlaelvertgcglllDvnNvyvna 175
                            +Hl+++ ++g + +dllP+pyteea+avv+++i+ +qd+LerplllEn+ssy++f+++++ E++Flae+++rtgc lllD+nN+yv+a
  SwissProt::A0A0H3CC29  96 DHLCWTGVEGFNSHDLLPVPYTEEAMAVVCANIALAQDVLERPLLLENPSSYVTFANDAMAEHQFLAEMCARTGCYLLLDINNIYVSA 183
                            **************************************************************************************** PP

                 DUF692 176 vNhgfdpeayldalplervaeiHlAGheekeelliDtHgapvadevwalleealarlgpvptllErDnnipplaellaelakara 260
                             Nhgfdp++yl+a+p++rv +iHlAGh++++elliDtH++pv+d+vwal+e+a+ r+gpv+ ++ErD++ippl++llael+ ara
  SwissProt::A0A0H3CC29 184 SNHGFDPYEYLAAVPVDRVLQIHLAGHSQGRELLIDTHDQPVPDSVWALYEAAAGRFGPVAAMIERDDDIPPLDDLLAELDVARA 268
                            ********************************************************************************99986 PP



Or compare SwissProt::A0A0H3CC29 to CDD or PaperBLAST