PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS100059 to PF05114 (DUF692)

VIMSS100059 has 280 amino acids

Query:       DUF692  [M=263]
Accession:   PF05114.13
Description: Protein of unknown function (DUF692)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   1.3e-101  325.3   0.0   1.5e-101  325.1   0.0    1.0  1  VIMSS100059  


Domain annotation for each sequence (and alignments):
>> VIMSS100059  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  325.1   0.0  1.5e-101  1.5e-101       2     261 ..       5     267 ..       4     269 .. 0.97

  Alignments for each domain:
  == domain 1  score: 325.1 bits;  conditional E-value: 1.5e-101
       DUF692   2 vGlglrrelleelleekpevdflEvaaenylkaggkarkelealreryplvlHGvslslGsaepldeehlkrlkallerlepalvSeHlsfssaggve 99 
                  +Glgl+++++ ++++ ++e  ++Ev++eny++agg++ ++lea+r+r p++lHGv+lsl++ +  d ehl++lk+l++r++p +vSeHl++s+++g++
  VIMSS100059   5 AGLGLKSQHYGDAIACDAEGLWFEVHPENYMSAGGPRLAALEAVRARRPVSLHGVGLSLAADTDPDPEHLQALKRLVDRFDPFVVSEHLAWSTHRGAH 102
                  8*************99999******************************************************************************* PP

       DUF692 100 lndllPlpyteealavvaerikqvqdiLerplllEnvssylafpeselsEaeFlaelvertgcglllDvnNvyvnavNhgfdpeayldalplervaei 197
                    dllP+p+t++al++++ +++++qd+L+r++l+En+s yl ++ ++l+E++Fl++l++rtgcgll+DvnNv+v+a+N g+ pe+yldalp++++ ei
  VIMSS100059 103 HPDLLPFPRTRAALDRICGNVARMQDALQRRVLIENPSLYLPLKGHALDEVDFLEALATRTGCGLLVDVNNVFVSAQNLGYAPETYLDALPAHAIGEI 200
                  ************************************************************************************************** PP

       DUF692 198 HlAGh...eekeelliDtHgapvadevwalleealarlgpvptllErDnnipplaellaelakarai 261
                  HlAGh     +++lliDtHgapva+ vw+l+++++ar+gp+ptl+ErD++ip++a l+ae ++a a+
  VIMSS100059 201 HLAGHapdPGGSNLLIDTHGAPVAEVVWTLYARLIARIGPRPTLIERDDDIPDFAALMAERNRAVAV 267
                  *****65322667*************************************************99876 PP



Or compare VIMSS100059 to CDD or PaperBLAST