PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS208514 to PF05114 (DUF692)

VIMSS208514 has 265 amino acids

Query:       DUF692  [M=263]
Accession:   PF05114.13
Description: Protein of unknown function (DUF692)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    8.3e-18   50.6   0.0    1.1e-17   50.2   0.0    1.1  1  VIMSS208514  


Domain annotation for each sequence (and alignments):
>> VIMSS208514  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   50.2   0.0   1.1e-17   1.1e-17     111     241 ..     113     242 ..     107     260 .. 0.90

  Alignments for each domain:
  == domain 1  score: 50.2 bits;  conditional E-value: 1.1e-17
       DUF692 111 ealavvaerikqvqdiLerplllEnvssylafpeselsEaeFlaelvertgcglllDvnNvyvnavNhgfdpeayldalplervaeiHlAGheekeel 208
                  + ++v  e +++++++++ +l  E + +y +   +++ + +F+++ ++  +++lllD+    ++a + g+d +ayldalpl+rv e+H +    + ++
  VIMSS208514 113 ALIEVAQEGVARIREHFDGTLKFEILNYYPTGVYDHVCDPAFIHRFLDALDAQLLLDIGHARISAAHLGYDFAAYLDALPLHRVTEVHYSRPGLELGV 210
                  456777889********************************************************************************96655679* PP

       DUF692 209 liDtHgapvadevwalleealarlgpvptllEr 241
                  + DtH++p ade +al +++lar+  +++++E 
  VIMSS208514 211 WEDTHERPGADEALAL-RHILARAPVRHVVIEY 242
                  **************97.7899998888999997 PP



Or compare VIMSS208514 to CDD or PaperBLAST