PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5850287 to PF05114 (DUF692)

VIMSS5850287 has 289 amino acids

Query:       DUF692  [M=263]
Accession:   PF05114.13
Description: Protein of unknown function (DUF692)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
   5.2e-113  362.7   0.0   5.9e-113  362.5   0.0    1.0  1  VIMSS5850287  


Domain annotation for each sequence (and alignments):
>> VIMSS5850287  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  362.5   0.0  5.9e-113  5.9e-113       1     260 [.      17     277 ..      17     280 .. 0.98

  Alignments for each domain:
  == domain 1  score: 362.5 bits;  conditional E-value: 5.9e-113
        DUF692   1 gvGlglrrelleelleekpe.vdflEvaaenylkaggkarkelealreryplvlHGvslslGsaepldeehlkrlkallerlepalvSeHlsfssag 96 
                   g+Glglr+++++++l+++++ vdf+Ev++en++  gg++ ++++a+reryp++lHGvs+s+Gsa++++ ++l+rlk l++r++p +vS+Hl+++ ++
  VIMSS5850287  17 GFGLGLRPPHYRAFLDSERPlVDFVEVISENFMVGGGRPLHVIDAVRERYPVALHGVSMSVGSADGVKLDYLRRLKGLADRVDPMWVSDHLCWTGVE 113
                   58*************866667**************************************************************************** PP

        DUF692  97 gvelndllPlpyteealavvaerikqvqdiLerplllEnvssylafpeselsEaeFlaelvertgcglllDvnNvyvnavNhgfdpeayldalpler 193
                   g + +dllP+pyteea+avv+++i+ +qd+LerplllEn+ssy++f+++++ E++Flae+++rtgc lllD+nN+yv+a Nhgfdp++yl+a+p++r
  VIMSS5850287 114 GFNSHDLLPVPYTEEAMAVVCANIALAQDVLERPLLLENPSSYVTFANDAMAEHQFLAEMCARTGCYLLLDINNIYVSASNHGFDPYEYLAAVPVDR 210
                   ************************************************************************************************* PP

        DUF692 194 vaeiHlAGheekeelliDtHgapvadevwalleealarlgpvptllErDnnipplaellaelakara 260
                   v +iHlAGh++++elliDtH++pv+d+vwal+e+a+ r+gpv+ ++ErD++ippl++llael+ ara
  VIMSS5850287 211 VLQIHLAGHSQGRELLIDTHDQPVPDSVWALYEAAAGRFGPVAAMIERDDDIPPLDDLLAELDVARA 277
                   **************************************************************99986 PP



Or compare VIMSS5850287 to CDD or PaperBLAST