PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS59733 to PF05114 (DUF692)

VIMSS59733 has 284 amino acids

Query:       DUF692  [M=263]
Accession:   PF05114.13
Description: Protein of unknown function (DUF692)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
   1.1e-101  325.5   0.0   1.3e-101  325.3   0.0    1.0  1  VIMSS59733  


Domain annotation for each sequence (and alignments):
>> VIMSS59733  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  325.3   0.0  1.3e-101  1.3e-101       1     262 [.       8     269 ..       8     270 .. 0.96

  Alignments for each domain:
  == domain 1  score: 325.3 bits;  conditional E-value: 1.3e-101
      DUF692   1 gvGlglrrelleelle.ekpevdflEvaaenylkaggkarkelealreryplvlHGvslslGsaepldeehlkrlkallerlepalvSeHlsfssaggv 98 
                 g+Glglrr lle l + +  +vdflEva+en+++ gg+  +++++l+er+p+++HG+sl+lG+ +pld + l+++k ++e+++++ +SeHls ++++g 
  VIMSS59733   8 GAGLGLRRALLEPLGAgDGVRVDFLEVAPENWIGIGGRLGRQFRELTERLPFLCHGLSLNLGGYAPLDMSLLRAIKGFIEQHDIRAYSEHLSACADDG- 105
                 68************9534455**************************************************************************999. PP

      DUF692  99 elndllPlpyteealavvaerikqvqdiLerplllEnvssylafpeselsEaeFlaelvertgcglllDvnNvyvnavNhgfdpeayldalplervaei 197
                 +l+dl+Plp+++e++++vaer++ vqd+Lerpl++Envs+y ++p  el+E++F+++++e+++c+lllDvnNvyvna+N gfd++ay++a+p +r+a++
  VIMSS59733 106 QLYDLMPLPFSDESVRRVAERVRVVQDVLERPLIVENVSAYARLP-GELEEVDFVRAVLEEADCQLLLDVNNVYVNACNFGFDAHAYIAAMPSRRIAYL 203
                 *****************************************8887.59*************************************************** PP

      DUF692 198 HlAGh.eekeelliDtHgapvadevwalleealarlgpvptllErDnnipplaellaelakarail 262
                 H+AGh e++++l iDtHgapv+d+vw+ll++a+a +g++ptllErD+n+ppl+el+ae++++r+++
  VIMSS59733 204 HMAGHdEQGASLKIDTHGAPVCDPVWELLAHAYACHGERPTLLERDFNLPPLSELYAETDRIRELQ 269
                 *****555777****************************************************987 PP



Or compare VIMSS59733 to CDD or PaperBLAST