PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS60555 to PF05114 (DUF692)

VIMSS60555 has 276 amino acids

Query:       DUF692  [M=263]
Accession:   PF05114.13
Description: Protein of unknown function (DUF692)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
   1.3e-101  325.3   0.0   1.5e-101  325.1   0.0    1.0  1  VIMSS60555  


Domain annotation for each sequence (and alignments):
>> VIMSS60555  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  325.1   0.0  1.5e-101  1.5e-101       2     262 ..       8     268 ..       7     269 .. 0.98

  Alignments for each domain:
  == domain 1  score: 325.1 bits;  conditional E-value: 1.5e-101
      DUF692   2 vGlglrrelleelleekpe.vdflEvaaenylkaggkarkelealreryplvlHGvslslGsaepldeehlkrlkallerlepalvSeHlsfssaggve 99 
                 +Glglrr ll +ll+  p  vdflE+a++n+++ gg+  + le+l er+pl++HG+slslG+++pld++++++ +++l r+++al+SeHls++s++g +
  VIMSS60555   8 AGLGLRRGLLPQLLAMAPGaVDFLECAPDNWIGVGGAFGADLERLVERIPLTCHGLSLSLGGSTPLDAAFIEQTRRFLVRHRVALYSEHLSYCSDDG-H 105
                 8*************888879****************************************************************************9.* PP

      DUF692 100 lndllPlpyteealavvaerikqvqdiLerplllEnvssylafpeselsEaeFlaelvertgcglllDvnNvyvnavNhgfdpeayldalplervaeiH 198
                 l+dllPlp+te+a+++va+ri+++q++Ler++++En+s+y a+p +e+sE+eF+++++++++c+lllDvnN++vna+Nhg+d+ ++l +lp  rva +H
  VIMSS60555 106 LYDLLPLPFTEAAVRHVAARIREAQERLERRIAVENISYY-AAPYREMSEIEFVNAVLDEADCDLLLDVNNLFVNACNHGYDALDFLVRLPPGRVAAYH 203
                 ****************************************.999******************************************************* PP

      DUF692 199 lAGh.eekeelliDtHgapvadevwalleealarlgpvptllErDnnipplaellaelakarail 262
                 +AGh +e+ +l iDtHga+v+  vwall +a++r+g +ptllErD+n+ppl ell e++++r+ +
  VIMSS60555 204 VAGHyDEAPDLKIDTHGAAVKPGVWALLGAAYRRFGVRPTLLERDFNYPPLGELLLEVEQIRQWQ 268
                 ****766778****************************************************986 PP



Or compare VIMSS60555 to CDD or PaperBLAST