PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS741619 to PF05114 (DUF692)

VIMSS741619 has 303 amino acids

Query:       DUF692  [M=263]
Accession:   PF05114.13
Description: Protein of unknown function (DUF692)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   7.3e-105  336.0   0.0   8.3e-105  335.8   0.0    1.0  1  VIMSS741619  


Domain annotation for each sequence (and alignments):
>> VIMSS741619  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  335.8   0.0  8.3e-105  8.3e-105       2     262 ..      23     288 ..      22     289 .. 0.97

  Alignments for each domain:
  == domain 1  score: 335.8 bits;  conditional E-value: 8.3e-105
       DUF692   2 vGlglrrelleelleekpevdflEvaaenylkaggkarkelealreryplvlHGvslslGsaepldeehlkrlkallerlepalvSeHlsfssaggve 99 
                  vG ++++ ++++++++  + +f+Ev+aeny+++gg+++++l+alre+yp+++HGv+ls+G+++pld++hl+r++++++r+ep+lvSeHl++ss+gg+ 
  VIMSS741619  23 VGTSFKPCHFADIVDNGLQDGFFEVHAENYMGKGGPPHRALSALRETYPVSVHGVCLSIGGPSPLDAHHLARFRDVVARYEPVLVSEHLAWSSHGGAF 120
                  799***********99999******************************************************************************* PP

       DUF692 100 lndllPlpyteealavvaerikqvqdiLerplllEnvssylafpeselsEaeFlaelvertgcglllDvnNvyvnavNhgfdpeayldalplervaei 197
                  +ndllPlpyt+++l++v+++++q+q+++ rplllEn+s+y+ f++s++sE+eF+a+++ rtgcglllD+nN +v+a+Nhg ++++yl+++ple+v ei
  VIMSS741619 121 YNDLLPLPYTKATLDRVCAHVDQIQEAIARPLLLENPSTYVGFASSTMSETEFIAAVAGRTGCGLLLDINNAFVSATNHGCSAADYLADFPLEQVGEI 218
                  ************************************************************************************************** PP

       DUF692 198 HlAGh.....eekeelliDtHgapvadevwalleealarlgpvptllErDnnipplaellaelakarail 262
                  HlAGh     +e+e lliD+H++p+a +vwal+++++ar+gpvptl+E+D+++p++ +l a++ +ar+i+
  VIMSS741619 219 HLAGHseqrdDEDEPLLIDSHDRPIAGPVWALYASVIARTGPVPTLVEWDSQLPDWLVLRAQALEARRIM 288
                  *****6544333455***************************************************9986 PP



Or compare VIMSS741619 to CDD or PaperBLAST