PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS757139 to PF05114 (DUF692)

VIMSS757139 has 275 amino acids

Query:       DUF692  [M=263]
Accession:   PF05114.13
Description: Protein of unknown function (DUF692)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   6.9e-105  336.0   0.0   7.7e-105  335.9   0.0    1.0  1  VIMSS757139  


Domain annotation for each sequence (and alignments):
>> VIMSS757139  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  335.9   0.0  7.7e-105  7.7e-105       2     258 ..      10     271 ..       9     275 .] 0.97

  Alignments for each domain:
  == domain 1  score: 335.9 bits;  conditional E-value: 7.7e-105
       DUF692   2 vGlglrrelleelleekpevdflEvaaenylkaggkarkelealreryplvlHGvslslGsaepldeehlkrlkallerlepalvSeHlsfssaggve 99 
                  +G+glr+++++++leekp++d+lEv++en+l++gg+  + l++++++ypl++HGv+lslGsae++  +hl+r+k+l++r++pal+S+Hls+s+ g+++
  VIMSS757139  10 TGIGLRAPHYAQILEEKPDIDWLEVHTENFLAEGGPLLELLDSISQHYPLSFHGVGLSLGSAEGVCIAHLNRIKTLIDRFQPALLSDHLSWSTIGNTY 107
                  6************************************************************************************************* PP

       DUF692 100 lndllPlpyteealavvaerikqvqdiLerplllEnvssylafpeselsEaeFlaelvertgcglllDvnNvyvnavNhgfdpeayldalplervaei 197
                  l dllP+py+ee+l+++ ++i++vq++L+r+ll+En++syl++++s++sE +Flae+++rt+++lllD+nN+yv++ N++ dp++y++++p+e+v+ei
  VIMSS757139 108 LPDLLPIPYNEESLTIISNNIDRVQNYLKRTLLIENPASYLEYQTSSYSEPDFLAEIIKRTEARLLLDINNIYVSCSNNKRDPYQYIQRIPHEAVQEI 205
                  ************************************************************************************************** PP

       DUF692 198 HlAGh.....eekeelliDtHgapvadevwalleealarlgpvptllErDnnipplaellaelaka 258
                  HlAGh     ++++ l iDtH++ v+ evw+l+++a++ +g vptllE+D++ip+l++ll+e++k 
  VIMSS757139 206 HLAGHsivyqDNTNFLRIDTHNNYVCPEVWDLYRYAIHYTGLVPTLLEWDTEIPSLDTLLNEARKS 271
                  *****88875445669**********************************************9875 PP



Or compare VIMSS757139 to CDD or PaperBLAST