PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS758568 to PF05114 (DUF692)

VIMSS758568 has 284 amino acids

Query:       DUF692  [M=263]
Accession:   PF05114.13
Description: Protein of unknown function (DUF692)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
     3e-103  330.7   0.0   3.4e-103  330.5   0.0    1.0  1  VIMSS758568  


Domain annotation for each sequence (and alignments):
>> VIMSS758568  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  330.5   0.0  3.4e-103  3.4e-103       2     261 ..       7     271 ..       6     273 .. 0.98

  Alignments for each domain:
  == domain 1  score: 330.5 bits;  conditional E-value: 3.4e-103
       DUF692   2 vGlglrrelleelleekpevdflEvaaenylkaggkarkelealreryplvlHGvslslGsaepldeehlkrlkallerlepalvSeHlsfssaggve 99 
                  +G+glr ++++++lee+p+++++Ev++en++++gg++ k+l +++e yp++lHGv+lslGs++++++ hl+rl++l+++++p++vSeHls+ ++gg++
  VIMSS758568   7 IGIGLRYPHYTQVLEERPSIGWFEVHSENFFSNGGNEIKALLNISEYYPISLHGVGLSLGSSDGISKVHLDRLSNLVHQVQPKFVSEHLSWGHVGGIH 104
                  7************************************************************************************************* PP

       DUF692 100 lndllPlpyteealavvaerikqvqdiLerplllEnvssylafpeselsEaeFlaelvertgcglllDvnNvyvnavNhgfdpeayldalplervaei 197
                  + dllP+pytee+++++ + i+ +qd+L+r++l+En+ssy+++++s+l+E  Fl el+++tg+++llDvnN+++++ Nhg+++++y+d++p + v+ei
  VIMSS758568 105 MPDLLPVPYTEESFNTFKRSISIAQDFLKREILIENPSSYIEYKSSRLHESYFLVELCNQTGAKILLDVNNLFISSWNHGWNTKEYIDSIPFNLVKEI 202
                  ************************************************************************************************** PP

       DUF692 198 HlAGh.....eekeelliDtHgapvadevwalleealarlgpvptllErDnnipplaellaelakarai 261
                  H+AGh     +++++l iDtH++ v+devwal++++++r+gp+ptllE+D++ip+l++l++e++k +++
  VIMSS758568 203 HIAGHsikelSNDSTLRIDTHNNYVCDEVWALYDYTVQRFGPIPTLLEWDADIPSLNVLIEEASKCESY 271
                  *****8876655778*************************************************99876 PP



Or compare VIMSS758568 to CDD or PaperBLAST