PaperBLAST – Find papers about a protein or its homologs

 

Align WP_011519118.1 to PF05114 (DUF692)

WP_011519118.1 has 278 amino acids

Query:       DUF692  [M=263]
Accession:   PF05114.13
Description: Protein of unknown function (DUF692)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   1.5e-105  338.2   0.0   1.7e-105  338.1   0.0    1.0  1  WP_011519118.1  


Domain annotation for each sequence (and alignments):
>> WP_011519118.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  338.1   0.0  1.7e-105  1.7e-105       2     262 ..       7     271 ..       6     272 .. 0.97

  Alignments for each domain:
  == domain 1  score: 338.1 bits;  conditional E-value: 1.7e-105
          DUF692   2 vGlglrrelleelleekpevdflEvaaenylkaggkarkelealreryplvlHGvslslGsaepldeehlkrlkallerlepalvSeHlsfssag 96 
                     +Glgl+++++e++l+  ++  ++Ev++enyl agg++ ++l+a+rer+p++lHGvslsl++ +p de+hl+rl+all+r+ep+lvSeHl++s+ +
  WP_011519118.1   7 AGLGLKPQHFEQALQCAEPGLWFEVHPENYLMAGGPRLAWLTAIRERHPVALHGVSLSLAGDAPPDEAHLDRLHALLRRIEPVLVSEHLAWSTLD 101
                     8*************99999**************************************************************************** PP

          DUF692  97 gvelndllPlpyteealavvaerikqvqdiLerplllEnvssylafpeselsEaeFlaelvertgcglllDvnNvyvnavNhgfdpeayldalpl 191
                     g+++ dllP+++t + la va++i++vqd+L+  ++lEn+s+yl+++e+++sE++Flaelv+rtgcglllD+nNvyv+a+N g+d+ +yl+++p+
  WP_011519118.1 102 GRYVPDLLPVARTTARLAKVAANISRVQDRLGCAIALENPSHYLRMDEHDWSETDFLAELVRRTGCGLLLDINNVYVSARNMGYDAWDYLTRVPA 196
                     *********************************************************************************************** PP

          DUF692 192 ervaeiHlAGh....eekeelliDtHgapvadevwalleealarlgpvptllErDnnipplaellaelakarail 262
                     e+v+eiHlAGh    e +++lliD+H+apva++vw+l+++++ar+g++ptl+ErD+nip++a+ll+e ++a++il
  WP_011519118.1 197 EAVREIHLAGHsfddEFGASLLIDSHDAPVAEAVWSLYRRFVARVGERPTLIERDDNIPEFADLLDERDRAQSIL 271
                     ***********765333677***************************************************9986 PP



Or compare WP_011519118.1 to CDD or PaperBLAST