PaperBLAST – Find papers about a protein or its homologs

 

Align WP_036166599.1 to PF05114 (DUF692)

WP_036166599.1 has 272 amino acids

Query:       DUF692  [M=263]
Accession:   PF05114.13
Description: Protein of unknown function (DUF692)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   1.2e-103  332.0   0.0   1.3e-103  331.9   0.0    1.0  1  WP_036166599.1  


Domain annotation for each sequence (and alignments):
>> WP_036166599.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  331.9   0.0  1.3e-103  1.3e-103       2     262 ..       8     268 ..       7     269 .. 0.98

  Alignments for each domain:
  == domain 1  score: 331.9 bits;  conditional E-value: 1.3e-103
          DUF692   2 vGlglrrelleelleekpe..vdflEvaaenylkaggkarkelealreryplvlHGvslslGsaepldeehlkrlkallerlepalvSeHlsfss 94 
                     +Glglrr ll +l+ + p+  +dflE+a+en+++ gg+  +++++l++r+p+++HG+slslG+++pld  +++r+ a+l+r+ ++ +SeHls++s
  WP_036166599.1   8 AGLGLRRALLGALQ-DAPAgaFDFLECAPENWIGVGGRLGDAFASLAARHPITCHGLSLSLGGPAPLDDGFVDRVGAFLDRHAVRDYSEHLSYCS 101
                     8************9.555559************************************************************************** PP

          DUF692  95 aggvelndllPlpyteealavvaerikqvqdiLerplllEnvssylafpeselsEaeFlaelvertgcglllDvnNvyvnavNhgfdpeayldal 189
                     ++g +l+dllP+p+t++a+++v +ri++vqd+L+r++++Envs+y a+p+++l+Ea+F+++++e ++c+lllDvnNvyvn++Nhg+d++a+l+a+
  WP_036166599.1 102 DDG-QLYDLLPIPFTDAAVRHVSDRIRRVQDRLGRRIAIENVSYY-AAPHRALDEADFVNAVLEAADCDLLLDVNNVYVNSINHGYDARAFLAAM 194
                     **9.*****************************************.999********************************************** PP

          DUF692 190 plervaeiHlAGh.eekeelliDtHgapvadevwalleealarlgpvptllErDnnipplaellaelakarail 262
                     p++rv ++H+AGh +e+++l +DtHgapv+d+vwall++a+a +g +ptllErD+n+p++++llae++++r+i+
  WP_036166599.1 195 PTARVTQYHIAGHfDEADDLKVDTHGAPVIDDVWALLDHAYALHGVHPTLLERDFNFPAFDVLLAEVERIREIQ 268
                     *************877899****************************************************997 PP



Or compare WP_036166599.1 to CDD or PaperBLAST