PaperBLAST – Find papers about a protein or its homologs

 

Align WP_042071638.1 to PF05114 (DUF692)

WP_042071638.1 has 299 amino acids

Query:       DUF692  [M=263]
Accession:   PF05114.13
Description: Protein of unknown function (DUF692)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   1.6e-104  334.8   0.0   1.8e-104  334.6   0.0    1.0  1  WP_042071638.1  


Domain annotation for each sequence (and alignments):
>> WP_042071638.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  334.6   0.0  1.8e-104  1.8e-104       2     261 ..      16     280 ..      15     282 .. 0.97

  Alignments for each domain:
  == domain 1  score: 334.6 bits;  conditional E-value: 1.8e-104
          DUF692   2 vGlglrrelleelleekpevdflEvaaenylkaggkarkelealreryplvlHGvslslGsaepldeehlkrlkallerlepalvSeHlsfssag 96 
                     +G+++++e+l+++++++ +  f+Ev+aeny+++gg+++++l+a+r++ypl++HGv++s+G+++ ld++hl+r+++l++r+ep lvSeHl++s+ +
  WP_042071638.1  16 AGVSFKHEHLRAIQQDTLTDAFFEVHAENYMGEGGPPQQALAAIRRDYPLSVHGVCMSIGGPQVLDSNHLRRFADLVRRCEPLLVSEHLAWSAYD 110
                     7*************99999**************************************************************************** PP

          DUF692  97 gvelndllPlpyteealavvaerikqvqdiLerplllEnvssylafpeselsEaeFlaelvertgcglllDvnNvyvnavNhgfdpeayldalpl 191
                     ++ +ndllPlpyt+++l++v+++i+qvq +++r ll+En+++y+++++se+sE+ Fl+e+++rtgcglllD+nNvyv+a+Nhgf++e+yl+++pl
  WP_042071638.1 111 NTFYNDLLPLPYTSDTLHTVCDHIDQVQVAIGRSLLIENPATYIQYASSEMSETGFLREVARRTGCGLLLDINNVYVSAINHGFSAETYLADFPL 205
                     *********************************************************************************************** PP

          DUF692 192 ervaeiHlAGh.....eekeelliDtHgapvadevwalleealarlgpvptllErDnnipplaellaelakarai 261
                     +rv +iHlAGh     +e++ lliD+H+a+va +vw+l+++++a +g vptl+E+D+++p++ +l a   ++r++
  WP_042071638.1 206 DRVGQIHLAGHcaqedDEGQPLLIDSHDAEVAPAVWDLYKQVIASTGLVPTLVEWDSRLPAWPVLEAHRLQVRDC 280
                     ***********8764433555********************************************9998888876 PP



Or compare WP_042071638.1 to CDD or PaperBLAST