PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::Kang:B158DRAFT_1333 to PF05114 (DUF692)

reanno::Kang:B158DRAFT_1333 has 281 amino acids

Query:       DUF692  [M=263]
Accession:   PF05114.13
Description: Protein of unknown function (DUF692)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                    -----------
   7.7e-108  345.7   0.0   8.8e-108  345.5   0.0    1.0  1  reanno::Kang:B158DRAFT_1333  


Domain annotation for each sequence (and alignments):
>> reanno::Kang:B158DRAFT_1333  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  345.5   0.0  8.8e-108  8.8e-108       1     262 [.       9     270 ..       9     271 .. 0.97

  Alignments for each domain:
  == domain 1  score: 345.5 bits;  conditional E-value: 8.8e-108
                       DUF692   1 gvGlglrrelleelle.ekpevdflEvaaenylkaggkarkelealreryplvlHGvslslGsaepldeehlkrlkallerl 81 
                                  g+Glglrr++l+e+ + ++++vdf+Eva+en++  gg+ ++++++ +er+p+v+HG+sls+G+++pld++++k+++++++++
  reanno::Kang:B158DRAFT_1333   9 GAGLGLRRDFLDEYEAlDQSTVDFMEVAPENWIPYGGRLKDQFKRYAERFPFVIHGLSLSIGGPTPLDTDFVKQVAEFIKTY 90 
                                  68***********99635555************************************************************* PP

                       DUF692  82 epalvSeHlsfssaggvelndllPlpyteealavvaerikqvqdiLerplllEnvssylafpeselsEaeFlaelvertgcg 163
                                  +++++SeHls++s++g +++dl+P+p+teea+++va+ri+qvqdi+++++++Envs+y a+p +e+sE+eFl +++e+++c+
  reanno::Kang:B158DRAFT_1333  91 DIQCYSEHLSYCSDDG-HMYDLMPIPFTEEAVHYVAKRIQQVQDIIGQQIAMENVSYY-AAPGQEMSELEFLLAVLEEADCK 170
                                  ***************9.*****************************************.99********************* PP

                       DUF692 164 lllDvnNvyvnavNhgfdpeayldalplervaeiHlAGh.eekeelliDtHgapvadevwalleealarlgpvptllErDnn 244
                                  lllDvnN+yvn++Nh+++pe++l+alp er+a+ H+AGh +e+e+l +DtHg++v+ evw+ll+ a++++g +ptllErD+n
  reanno::Kang:B158DRAFT_1333 171 LLLDVNNIYVNSINHKYNPEQFLKALPKERIAYGHIAGHyDEAEDLKVDTHGSDVKPEVWNLLDLAYEQFGVFPTLLERDFN 252
                                  ***************************************877889************************************* PP

                       DUF692 245 ipplaellaelakarail 262
                                  ip++a+ll+e+++++a++
  reanno::Kang:B158DRAFT_1333 253 IPSMAKLLKEVEQIKALQ 270
                                  ***************987 PP



Or compare reanno::Kang:B158DRAFT_1333 to CDD or PaperBLAST