PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::Phaeo:GFF2068 to PF05114 (DUF692)

reanno::Phaeo:GFF2068 has 282 amino acids

Query:       DUF692  [M=263]
Accession:   PF05114.13
Description: Protein of unknown function (DUF692)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence              Description
    ------- ------ -----    ------- ------ -----   ---- --  --------              -----------
   7.2e-106  339.3   0.0   8.2e-106  339.1   0.0    1.0  1  reanno::Phaeo:GFF2068  


Domain annotation for each sequence (and alignments):
>> reanno::Phaeo:GFF2068  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  339.1   0.0  8.2e-106  8.2e-106       2     262 ..      12     277 ..      11     278 .. 0.97

  Alignments for each domain:
  == domain 1  score: 339.1 bits;  conditional E-value: 8.2e-106
                 DUF692   2 vGlglrrelleelleekpevdflEvaaenylkaggkarkelealreryplvlHGvslslGsaepldeehlkrlkallerlepalvSeH 89 
                            +G+g+++++++++l++  +v++lE++aeny+++gg++ ++l++l e++++++HGv+ls+G++ pld++hl+rlk+l+  l+pa +SeH
  reanno::Phaeo:GFF2068  12 TGVGYKPQHFADILADAGPVKWLEIHAENYMGDGGRPIAQLRHLCEQFAISVHGVGLSIGGEGPLDADHLARLKHLVGWLNPASFSEH 99 
                            7*************99999********************************************************************* PP

                 DUF692  90 lsfssaggvelndllPlpyteealavvaerikqvqdiLerplllEnvssylafpeselsEaeFlaelvertgcglllDvnNvyvnavN 177
                            l++s+++++ +ndllPlpyt+++la+v+++i+qvqd+++r++llEn+ssylaf+es++sE eFl+e+++rtgcglllDvnNv+v+a+N
  reanno::Phaeo:GFF2068 100 LAWSTHDSHFYNDLLPLPYTDATLARVCDHINQVQDTIGRRMLLENPSSYLAFAESSWSEPEFLTEITRRTGCGLLLDVNNVFVSATN 187
                            **************************************************************************************** PP

                 DUF692 178 hgfdpeayldalplervaeiHlAGh.....eekeelliDtHgapvadevwalleealarlgpvptllErDnnipplaellaelakara 260
                             +f+p+ y+da+ l++v eiHl Gh     ++++ lliD+Hga+v d+vwall+++la+ gp p+l+E+D+++p++ +l+ae+++a++
  reanno::Phaeo:GFF2068 188 LDFSPQGYIDAFALDQVGEIHLGGHdededDHGKPLLIDSHGAEVVDPVWALLDYTLAKSGPKPVLVEWDTDVPDWPVLAAEATRAAT 275
                            *************************6544333555**************************************************998 PP

                 DUF692 261 il 262
                            +l
  reanno::Phaeo:GFF2068 276 AL 277
                            75 PP



Or compare reanno::Phaeo:GFF2068 to CDD or PaperBLAST