PaperBLAST – Find papers about a protein or its homologs

 

Align reanno::SB2B:6937135 to PF05114 (DUF692)

reanno::SB2B:6937135 has 278 amino acids

Query:       DUF692  [M=263]
Accession:   PF05114.13
Description: Protein of unknown function (DUF692)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence             Description
    ------- ------ -----    ------- ------ -----   ---- --  --------             -----------
   1.5e-105  338.2   0.0   1.7e-105  338.0   0.0    1.0  1  reanno::SB2B:6937135  


Domain annotation for each sequence (and alignments):
>> reanno::SB2B:6937135  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  338.0   0.0  1.7e-105  1.7e-105       2     262 ..       7     267 ..       6     268 .. 0.98

  Alignments for each domain:
  == domain 1  score: 338.0 bits;  conditional E-value: 1.7e-105
                DUF692   2 vGlglrrelleelleekpe.vdflEvaaenylkaggkarkelealreryplvlHGvslslGsaepldeehlkrlkallerlepalvSeH 89 
                           +Glglrre+l+e+ ++ p+ +df+Eva+en+++ ggk+ k+++al+er+++++HG+sls+Gs++pld +++k +ka+l+ + +a++SeH
  reanno::SB2B:6937135   7 AGLGLRREMLAEFSQSVPAqIDFFEVAPENWMALGGKYGKQFRALTERHAFFCHGLSLSIGSSAPLDIDFIKGIKAFLDLHGIAVYSEH 95 
                           7*************988889********************************************************************* PP

                DUF692  90 lsfssaggvelndllPlpyteealavvaerikqvqdiLerplllEnvssylafpeselsEaeFlaelvertgcglllDvnNvyvnavNh 178
                           ls++s +g +l+dl+P+p+t ea++++a r+kqv+di+erpl+lEn+s y a+p ++++E+eF+ +++e+++c+lllDvnN+yvn++Nh
  reanno::SB2B:6937135  96 LSYCSGSG-HLYDLMPMPFTPEAVRHIAGRVKQVEDIIERPLILENISFY-AAPGAQMTELEFVLAVLEEADCQLLLDVNNIYVNSINH 182
                           ****9998.*****************************************.99************************************ PP

                DUF692 179 gfdpeayldalplervaeiHlAGh.eekeelliDtHgapvadevwalleealarlgpvptllErDnnipplaellaelakarail 262
                           ++d++ayl+a+p+er++++H+AGh  e+ +l++DtHga++ d+vw+ll +++a +gp+ptllErD+nipp+ ell+e++++r+++
  reanno::SB2B:6937135 183 NYDAAAYLAAMPTERIRYLHVAGHyVEAPDLIVDTHGADIVDPVWQLLCDCYALHGPLPTLLERDFNIPPIGELLQEIDRIRDYQ 267
                           ************************866788****************************************************987 PP



Or compare reanno::SB2B:6937135 to CDD or PaperBLAST