PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10088614 to PF05142 (DUF702)

VIMSS10088614 has 222 amino acids

Query:       DUF702  [M=150]
Accession:   PF05142.12
Description: Domain of unknown function (DUF702)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    1.1e-60  190.7   1.3    1.1e-60  190.7   1.3    1.5  2  VIMSS10088614  


Domain annotation for each sequence (and alignments):
>> VIMSS10088614  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.9   0.0      0.48      0.48      86      86 ..      28      28 ..       7      56 .. 0.46
   2 !  190.7   1.3   1.1e-60   1.1e-60       2     149 ..      69     206 ..      68     207 .. 0.84

  Alignments for each domain:
  == domain 1  score: -2.9 bits;  conditional E-value: 0.48
         DUF702 86 a 86
                    
  VIMSS10088614 28 Y 28
                   1 PP

  == domain 2  score: 190.7 bits;  conditional E-value: 1.1e-60
         DUF702   2 gisCqdCgnqakkdCahlrCRtCCksrgfdCetHvkstwvpaakrrerqqqlaalqaqqaeaeaaasassaeaskrpreekaaaasatslsatttk 97 
                    +isCq+Cgnqakk C+h rCRtCCks+g++C+tHv+stw+p+akrrerqqql++ +++ +          + +  ++r  +++a+  +s    ++ 
  VIMSS10088614  69 TISCQECGNQAKKGCTHGRCRTCCKSNGLHCPTHVRSTWIPIAKRRERQQQLQTPTSNPTG--------GSGRVGKYRDINQHATLDSSGL--EMG 154
                    689**********************************************999988765442........2333455664333333333333..456 PP

         DUF702  98 sesfpaevsseavFrcvrvssvddaedevaYqtavkigGhvfkGiLydqGpd 149
                    +++fp+evss+a+Frcvr+s++dd+e ++aYqt+v i+Gh+fkGiLy+qGp+
  VIMSS10088614 155 ETRFPDEVSSDALFRCVRMSGTDDGEGQYAYQTTVGIAGHLFKGILYNQGPE 206
                    679***********************************************98 PP



Or compare VIMSS10088614 to CDD or PaperBLAST