PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10089005 to PF05142 (DUF702)

VIMSS10089005 has 174 amino acids

Query:       DUF702  [M=150]
Accession:   PF05142.12
Description: Domain of unknown function (DUF702)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    6.5e-54  168.7  17.6      2e-29   89.2  15.7    2.2  2  VIMSS10089005  


Domain annotation for each sequence (and alignments):
>> VIMSS10089005  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   89.2  15.7     2e-29     2e-29       2      58 ..       6      62 ..       5      72 .. 0.90
   2 !   80.1   0.0   1.3e-26   1.3e-26      95     149 ..      71     125 ..      58     126 .. 0.87

  Alignments for each domain:
  == domain 1  score: 89.2 bits;  conditional E-value: 2e-29
         DUF702  2 gisCqdCgnqakkdCahlrCRtCCksrgfdCetHvkstwvpaakrrerqqqlaalqa 58
                   g++C+dCgnqakkdC+++rCRtCCks++f+C+tH+kstwvpa +r+++++q + l++
  VIMSS10089005  6 GRKCEDCGNQAKKDCVYMRCRTCCKSKAFHCQTHIKSTWVPAYRRSHHKHQSQPLST 62
                   579*******************************************99888776654 PP

  == domain 2  score: 80.1 bits;  conditional E-value: 1.3e-26
         DUF702  95 ttksesfpaevsseavFrcvrvssvddaedevaYqtavkigGhvfkGiLydqGpd 149
                    +t+  +fpae+ss a Frcv+vss+dd+++++aYqt+v+igGhvf+GiL+dqG++
  VIMSS10089005  71 HTTPGHFPAELSSLADFRCVKVSSIDDGKEQYAYQTTVNIGGHVFRGILHDQGLH 125
                    344569***********************************************86 PP



Or compare VIMSS10089005 to CDD or PaperBLAST