PaperBLAST – Find papers about a protein or its homologs

 

Align NP_012870.1 to PF05254 (UPF0203)

NP_012870.1 has 86 amino acids

Query:       UPF0203  [M=69]
Accession:   PF05254.12
Description: Uncharacterised protein family (UPF0203)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.8e-32   95.9   3.3    7.9e-32   95.7   3.3    1.0  1  NP_012870.1  


Domain annotation for each sequence (and alignments):
>> NP_012870.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   95.7   3.3   7.9e-32   7.9e-32       2      68 ..       8      74 ..       7      75 .. 0.98

  Alignments for each domain:
  == domain 1  score: 95.7 bits;  conditional E-value: 7.9e-32
      UPF0203  2 slspeCtelKeaYdeCFnkWfsekflkgkekeeeCeklwkkYreClkkalkekgleklleeareeap 68
                 s++peCt+lK++Yd+CFn+W+sekflkgk+ e+eC+k w +Y +C+++al ++g+++ l+eareeap
  NP_012870.1  8 SFAPECTDLKTKYDSCFNEWYSEKFLKGKSVENECSKQWYAYTTCVNAALVKQGIKPALDEAREEAP 74
                 99***************************************************************98 PP



Or compare NP_012870.1 to CDD or PaperBLAST