PaperBLAST – Find papers about a protein or its homologs

 

Align NP_057483.1 to PF05254 (UPF0203)

NP_057483.1 has 76 amino acids

Query:       UPF0203  [M=69]
Accession:   PF05254.12
Description: Uncharacterised protein family (UPF0203)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.1e-29   88.8   1.0    1.3e-29   88.6   1.0    1.1  1  NP_057483.1  


Domain annotation for each sequence (and alignments):
>> NP_057483.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   88.6   1.0   1.3e-29   1.3e-29       1      57 [.       2      58 ..       2      65 .. 0.96

  Alignments for each domain:
  == domain 1  score: 88.6 bits;  conditional E-value: 1.3e-29
      UPF0203  1 sslspeCtelKeaYdeCFnkWfsekflkgkekeeeCeklwkkYreClkkalkekgle 57
                 +s+++ Ct++K++Yd+CFn+Wf+ekflkg+++ ++C++l+k+Y++C++ka+kek++ 
  NP_057483.1  2 NSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIP 58
                 6999**************************************************986 PP



Or compare NP_057483.1 to CDD or PaperBLAST