NP_057483.1 has 76 amino acids
Query: UPF0203 [M=69]
Accession: PF05254.16
Description: Uncharacterised protein family (UPF0203)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.2e-31 93.3 0.8 4.8e-31 93.1 0.8 1.1 1 NP_057483.1
Domain annotation for each sequence (and alignments):
>> NP_057483.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 93.1 0.8 4.8e-31 4.8e-31 1 57 [. 2 58 .. 2 67 .. 0.95
Alignments for each domain:
== domain 1 score: 93.1 bits; conditional E-value: 4.8e-31
UPF0203 1 aslapeCtelKekYdkCFnkWysekflkgkskeeeCeklfkeYqeCvqkalkekgie 57
+s+++ Ct++K++Yd+CFn+W++ekflkg+s+ ++C++lfk+Yq+Cvqka+kek+i
NP_057483.1 2 NSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIP 58
699***************************************************997 PP
Or compare NP_057483.1 to CDD or PaperBLAST