PaperBLAST – Find papers about a protein or its homologs

 

Align NP_725705.2 to PF05254 (UPF0203)

NP_725705.2 has 88 amino acids

Query:       UPF0203  [M=69]
Accession:   PF05254.12
Description: Uncharacterised protein family (UPF0203)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.4e-28   84.0   1.0    4.8e-28   83.6   1.0    1.2  1  NP_725705.2  


Domain annotation for each sequence (and alignments):
>> NP_725705.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   83.6   1.0   4.8e-28   4.8e-28       1      60 [.       2      59 ..       2      64 .. 0.95

  Alignments for each domain:
  == domain 1  score: 83.6 bits;  conditional E-value: 4.8e-28
      UPF0203  1 sslspeCtelKeaYdeCFnkWfsekflkgkekeeeCeklwkkYreClkkalkekglekll 60
                 ss+++ C+elK++Yd+CFn+Wfse+flkg+ +++ C+ +++ Y+eC+k+a+kek+++  l
  NP_725705.2  2 SSVGEDCNELKQQYDACFNSWFSERFLKGQMDDSACAPIFRVYQECVKRAIKEKKID--L 59
                 6999**************************************************998..4 PP



Or compare NP_725705.2 to CDD or PaperBLAST