NP_647722.1 has 254 amino acids
Query: DUF725 [M=121] Accession: PF05267.16 Description: Protein of unknown function (DUF725) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-38 116.0 5.9 8.5e-38 115.3 5.9 1.4 1 NP_647722.1 Domain annotation for each sequence (and alignments): >> NP_647722.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 115.3 5.9 8.5e-38 8.5e-38 2 121 .] 61 180 .. 60 180 .. 0.99 Alignments for each domain: == domain 1 score: 115.3 bits; conditional E-value: 8.5e-38 DUF725 2 skeCfeeYlpelnevaeqyeaeytkCestaeeereeidakveeereqlessakelcsalqkCdsitdsldafeCyakagsenlkilysisanAselaa 99 s++Cf Y+ e+n +ae y+a+ytkC ++a+++r++ida++ ++r++++ s++++cs+l++C++++++l++f+C+a++gs+n+ ++ysis nAse+a+ NP_647722.1 61 SVACFGGYIGESNLIAELYSANYTKCYNAAADSRKGIDADFLATRRTIRLSSERVCSELRACNELNTTLESFQCHANVGSNNTVSTYSISGNASESAS 158 689*********************************************************************************************** PP DUF725 100 slseeysaidtteeqCtnkaer 121 l+e+y+++d ++ qC+++aer NP_647722.1 159 VLEERYRVVDLRHGQCCQRAER 180 ********************97 PP
Or compare NP_647722.1 to CDD or PaperBLAST