A7ENU3 has 1311 amino acids
Query: GSKIP_dom [M=105]
Accession: PF05303.16
Description: GSKIP domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.7e-09 23.4 0.0 6.8e-09 22.1 0.0 1.6 1 A7ENU3
Domain annotation for each sequence (and alignments):
>> A7ENU3
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 22.1 0.0 6.8e-09 6.8e-09 25 96 .. 224 295 .. 208 298 .. 0.92
Alignments for each domain:
== domain 1 score: 22.1 bits; conditional E-value: 6.8e-09
GSKIP_dom 25 lpsteevvylnvetkEgnelcielsakGfrivgskndtvkeksekedetkyyetlyaLLdkiSpkyrekFge 96
l+++ +++yl+v+t+Eg+++ i ++Gf + s++ + + + +++ + ++ +l aLL ++Sp+++ +F++
A7ENU3 224 LRQKGHLLYLQVTTNEGEQFQITSHVSGFYVNKSSTGKFDPSPKSAPKAHSAHSLLALLGDLSPSFEDSFKR 295
778899********************************98888899999999******************75 PP
Or compare A7ENU3 to CDD or PaperBLAST