PaperBLAST – Find papers about a protein or its homologs

 

Align NP_611095.1 to PF05303 (DUF727)

NP_611095.1 has 1448 amino acids

Query:       DUF727  [M=105]
Accession:   PF05303.12
Description: Protein of unknown function (DUF727)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.7e-10   27.3   0.0      6e-10   25.5   0.0    2.0  1  NP_611095.1  


Domain annotation for each sequence (and alignments):
>> NP_611095.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   25.5   0.0     6e-10     6e-10      29      96 ..     323     388 ..     319     395 .. 0.91

  Alignments for each domain:
  == domain 1  score: 25.5 bits;  conditional E-value: 6e-10
       DUF727  29 eeviylnvetlEgeelcvelsakGfrvvsskydeveeeeekedeekyfetlyaLLdkiSpeyrekFge 96 
                   +++yl v t+E++++ +  ++kGf + +s+ d+   + + ++ ++   +l  LL++iSp++r++F++
  NP_611095.1 323 GDLMYLYVVTMEDKRFHISACSKGFFINQSTDDTF--NPKPDNPSHLSHSLIDLLSHISPSFRRAFQT 388
                  5789**************************99999..888888999999*****************85 PP



Or compare NP_611095.1 to CDD or PaperBLAST