NP_611095.1 has 1448 amino acids
Query: GSKIP_dom [M=105]
Accession: PF05303.16
Description: GSKIP domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-10 26.8 0.0 8.5e-10 25.0 0.0 2.0 1 NP_611095.1
Domain annotation for each sequence (and alignments):
>> NP_611095.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 25.0 0.0 8.5e-10 8.5e-10 30 96 .. 324 388 .. 319 395 .. 0.91
Alignments for each domain:
== domain 1 score: 25.0 bits; conditional E-value: 8.5e-10
GSKIP_dom 30 evvylnvetkEgnelcielsakGfrivgskndtvkeksekedetkyyetlyaLLdkiSpkyrekFge 96
+++yl v t E++++ i ++kGf i +s++dt + + ++ ++ +l LL++iSp++r++F+
NP_611095.1 324 DLMYLYVVTMEDKRFHISACSKGFFINQSTDDTF--NPKPDNPSHLSHSLIDLLSHISPSFRRAFQT 388
689*******************************..888899999999*****************85 PP
Or compare NP_611095.1 to CDD or PaperBLAST