PaperBLAST – Find papers about a protein or its homologs

 

Align NP_848728.2 to PF05303 (DUF727)

NP_848728.2 has 144 amino acids

Query:       DUF727  [M=105]
Accession:   PF05303.12
Description: Protein of unknown function (DUF727)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.3e-38  115.9   0.0    6.7e-38  115.3   0.0    1.3  1  NP_848728.2  


Domain annotation for each sequence (and alignments):
>> NP_848728.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  115.3   0.0   6.7e-38   6.7e-38       1     105 []      38     138 ..      38     138 .. 0.98

  Alignments for each domain:
  == domain 1  score: 115.3 bits;  conditional E-value: 6.7e-38
       DUF727   1 lkkEaeaavnevafgVkeisvseklpsteeviylnvetlEgeelcvelsakGfrvvsskydeveeeeekedeekyfetlyaLLdkiSpeyrekFgekl 98 
                  +++Eaea+vn+v f+V+++ vs+++p  ++v+y+nvet+E +++c+el+++G rvv++++d+v    e++ ++ y+et+y+LLd++Sp+yre+Fg++l
  NP_848728.2  38 MQLEAEAVVNDVLFAVNHMFVSKSMPCADDVAYINVETKERNRYCLELTEAGLRVVGYAFDQV----EDHLQTPYHETVYSLLDTLSPAYREAFGNAL 131
                  579************************************************************....999**************************** PP

       DUF727  99 lekLekl 105
                  l++Le+l
  NP_848728.2 132 LQRLEAL 138
                  ****986 PP



Or compare NP_848728.2 to CDD or PaperBLAST