NP_848728.2 has 144 amino acids
Query: GSKIP_dom [M=105] Accession: PF05303.16 Description: GSKIP domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-39 119.4 0.0 5.5e-39 118.8 0.0 1.3 1 NP_848728.2 Domain annotation for each sequence (and alignments): >> NP_848728.2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 118.8 0.0 5.5e-39 5.5e-39 1 105 [] 38 138 .. 38 138 .. 0.98 Alignments for each domain: == domain 1 score: 118.8 bits; conditional E-value: 5.5e-39 GSKIP_dom 1 lkeEaeaavndvafaVkeisvseklpsteevvylnvetkEgnelcielsakGfrivgskndtvkeksekedetkyyetlyaLLdkiSpkyrekFgekl 98 ++ Eaea+vndv faV+++ vs+++p +++v+y+nvetkE+n++c+el+++G r+vg+++d+v e++ +t y+et+y+LLd++Sp+yre+Fg++l NP_848728.2 38 MQLEAEAVVNDVLFAVNHMFVSKSMPCADDVAYINVETKERNRYCLELTEAGLRVVGYAFDQV----EDHLQTPYHETVYSLLDTLSPAYREAFGNAL 131 578************************************************************....99***************************** PP GSKIP_dom 99 lekLeel 105 l++Le+l NP_848728.2 132 LQRLEAL 138 ****986 PP
Or compare NP_848728.2 to CDD or PaperBLAST