PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q8BGR8 to PF05303 (DUF727)

SwissProt::Q8BGR8 has 139 amino acids

Query:       DUF727  [M=105]
Accession:   PF05303.12
Description: Protein of unknown function (DUF727)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
      4e-38  116.0   0.0      6e-38  115.5   0.0    1.3  1  SwissProt::Q8BGR8  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q8BGR8  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  115.5   0.0     6e-38     6e-38       1     105 []      33     133 ..      33     133 .. 0.98

  Alignments for each domain:
  == domain 1  score: 115.5 bits;  conditional E-value: 6e-38
             DUF727   1 lkkEaeaavnevafgVkeisvseklpsteeviylnvetlEgeelcvelsakGfrvvsskydeveeeeekedeekyfetlyaLLdkiSpeyre 92 
                        +++Eaea+vn+v f+V+++ vs+++p  ++v+y+nvet+E +++c+el+++G rvv++++d+v    e++ ++ y+et+y+LLd++Sp+yre
  SwissProt::Q8BGR8  33 MQLEAEAVVNDVLFAVNHMFVSKSMPCADDVAYINVETKERNRYCLELTEAGLRVVGYAFDQV----EDHLQTPYHETVYSLLDTLSPAYRE 120
                        579************************************************************....999********************** PP

             DUF727  93 kFgekllekLekl 105
                        +Fg++ll++Le+l
  SwissProt::Q8BGR8 121 AFGNALLQRLEAL 133
                        **********986 PP



Or compare SwissProt::Q8BGR8 to CDD or PaperBLAST