PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q8BGR8 to PF05303 (GSKIP_dom)

SwissProt::Q8BGR8 has 139 amino acids

Query:       GSKIP_dom  [M=105]
Accession:   PF05303.16
Description: GSKIP domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    3.3e-39  119.5   0.0    4.9e-39  119.0   0.0    1.2  1  SwissProt::Q8BGR8  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q8BGR8  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  119.0   0.0   4.9e-39   4.9e-39       1     105 []      33     133 ..      33     133 .. 0.98

  Alignments for each domain:
  == domain 1  score: 119.0 bits;  conditional E-value: 4.9e-39
          GSKIP_dom   1 lkeEaeaavndvafaVkeisvseklpsteevvylnvetkEgnelcielsakGfrivgskndtvkeksekedetkyyetlyaLLdkiSpkyre 92 
                        ++ Eaea+vndv faV+++ vs+++p +++v+y+nvetkE+n++c+el+++G r+vg+++d+v    e++ +t y+et+y+LLd++Sp+yre
  SwissProt::Q8BGR8  33 MQLEAEAVVNDVLFAVNHMFVSKSMPCADDVAYINVETKERNRYCLELTEAGLRVVGYAFDQV----EDHLQTPYHETVYSLLDTLSPAYRE 120
                        578************************************************************....99*********************** PP

          GSKIP_dom  93 kFgekllekLeel 105
                        +Fg++ll++Le+l
  SwissProt::Q8BGR8 121 AFGNALLQRLEAL 133
                        **********986 PP



Or compare SwissProt::Q8BGR8 to CDD or PaperBLAST