PaperBLAST – Find papers about a protein or its homologs

 

Align XP_629429.1 to PF05303 (DUF727)

XP_629429.1 has 1320 amino acids

Query:       DUF727  [M=105]
Accession:   PF05303.12
Description: Protein of unknown function (DUF727)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.3e-10   25.9   0.0    2.4e-09   23.5   0.0    2.3  1  XP_629429.1  


Domain annotation for each sequence (and alignments):
>> XP_629429.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   23.5   0.0   2.4e-09   2.4e-09      30      99 ..     287     354 ..     282     356 .. 0.91

  Alignments for each domain:
  == domain 1  score: 23.5 bits;  conditional E-value: 2.4e-09
       DUF727  30 eviylnvetlEgeelcvelsakGfrvvsskydeveeeeekedeekyfetlyaLLdkiSpeyrekFgekll 99 
                  ++ yl ++ lEg ++cv  s++Gf + +s++ +   + + + + ++  +l++LL ++S  +r+ +++ l+
  XP_629429.1 287 DLFYLDITLLEGTTICVTASTQGFFINQSSNATF--NPSVSPKATINHSLHQLLTQVSRLFRRGLNQILT 354
                  688***********************99999999..778888899999**************99998776 PP



Or compare XP_629429.1 to CDD or PaperBLAST