PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2230658 to PF05305 (DUF732)

VIMSS2230658 has 111 amino acids

Query:       DUF732  [M=95]
Accession:   PF05305.14
Description: Protein of unknown function (DUF732)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    6.6e-31   92.9   2.4    7.9e-31   92.7   2.4    1.0  1  VIMSS2230658  


Domain annotation for each sequence (and alignments):
>> VIMSS2230658  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   92.7   2.4   7.9e-31   7.9e-31       2      93 ..       6      97 ..       5      99 .. 0.97

  Alignments for each domain:
  == domain 1  score: 92.7 bits;  conditional E-value: 7.9e-31
        DUF732  2 aaallaaalllaapAaAdsaddaFlaalnqagiaygspdaaialGkavCkkldsGksaeavvaevkndnsglspeqaaqfvgaAvsayCPeq 93
                  ++a++aa +++a pA+Ads ddaFlaaln+agi+y++p++ai++G++vC+   sG++  +++++v++ n+++s+ +aa fv+aA+ ayCP+ 
  VIMSS2230658  6 LLAGAAALVGMAIPAHADSDDDAFLAALNKAGITYPDPTRAIRAGQKVCDLAGSGTTELDIIRDVHELNPAFSTAKAALFVQAAAGAYCPDR 97
                  689999************************************************************99**********************97 PP



Or compare VIMSS2230658 to CDD or PaperBLAST