PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS33044 to PF05305 (DUF732)

VIMSS33044 has 113 amino acids

Query:       DUF732  [M=95]
Accession:   PF05305.14
Description: Protein of unknown function (DUF732)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.9e-27   81.8   6.2    2.4e-27   81.5   6.2    1.1  1  VIMSS33044  


Domain annotation for each sequence (and alignments):
>> VIMSS33044  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   81.5   6.2   2.4e-27   2.4e-27       3      94 ..      19     109 ..      17     110 .. 0.97

  Alignments for each domain:
  == domain 1  score: 81.5 bits;  conditional E-value: 2.4e-27
      DUF732   3 aallaaalllaapAaAdsaddaFlaalnqagiaygspdaaialGkavCkkldsGksaeavvaevkndnsglspeqaaqfvgaAvsayCPeql 94 
                 aa++++a+++a++A A+++d+aF+a++++ g++++sp+ a + ++ vCkkl+sG++ +++++ev + +++l+++qaa+fv++A++ayCP+++
  VIMSS33044  19 AAAIGLAVATAGTAGANTKDEAFIAQMESIGVTFSSPQVATQQAQLVCKKLASGETGTEIAEEVLS-QTNLTTKQAAYFVVDATKAYCPQYA 109
                 8999*************************************************************9.***********************97 PP



Or compare VIMSS33044 to CDD or PaperBLAST