VIMSS33044 has 113 amino acids
Query: DUF732 [M=72]
Accession: PF05305.18
Description: Protein of unknown function (DUF732)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.1e-24 70.4 0.5 7.1e-24 70.4 0.5 1.6 2 VIMSS33044
Domain annotation for each sequence (and alignments):
>> VIMSS33044
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -2.2 0.6 0.33 0.33 20 65 .. 19 25 .. 11 33 .. 0.49
2 ! 70.4 0.5 7.1e-24 7.1e-24 1 72 [] 37 107 .. 37 107 .. 0.98
Alignments for each domain:
== domain 1 score: -2.2 bits; conditional E-value: 0.33
DUF732 20 daaiaaGhqvCdaLdaGkspadvaaallasnpgltadqaaffvgaA 65
+ +g+A
VIMSS33044 19 A---------------------------------------AAIGLA 25
2.......................................223333 PP
== domain 2 score: 70.4 bits; conditional E-value: 7.1e-24
DUF732 1 aDdaFlaaLdqaGvtytdpdaaiaaGhqvCdaLdaGkspadvaaallasnpgltadqaaffvgaAiaayCPq 72
+D+aF+a++++ Gvt+++p+ a ++++ vC L++G++ +++a ++l++ ++lt++qaa+fv A++ayCPq
VIMSS33044 37 KDEAFIAQMESIGVTFSSPQVATQQAQLVCKKLASGETGTEIAEEVLSQ-TNLTTKQAAYFVVDATKAYCPQ 107
599**********************************************.*********8888********8 PP
Or compare VIMSS33044 to CDD or PaperBLAST