PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS33064 to PF05305 (DUF732)

VIMSS33064 has 111 amino acids

Query:       DUF732  [M=95]
Accession:   PF05305.14
Description: Protein of unknown function (DUF732)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    8.4e-28   83.0   9.3      1e-27   82.7   9.3    1.1  1  VIMSS33064  


Domain annotation for each sequence (and alignments):
>> VIMSS33064  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   82.7   9.3     1e-27     1e-27       2      94 ..      17     108 ..      16     109 .. 0.97

  Alignments for each domain:
  == domain 1  score: 82.7 bits;  conditional E-value: 1e-27
      DUF732   2 aaallaaalllaapAaAdsaddaFlaalnqagiaygspdaaialGkavCkkldsGksaeavvaevkndnsglspeqaaqfvgaAvsayCPeql 94 
                 aa l++aal++a++A+A+s+d+aFla+l++ gi+ +s+++ai+ ++avC++ld+G+sa+av+++v++  +gls++ a++f+++A+sayCP+++
  VIMSS33064  17 AATLGLAALGFAGTASASSTDEAFLAQLQADGITPPSAARAIKDAHAVCDALDEGHSAKAVIKAVAK-ATGLSAKGAKTFAVDAASAYCPQYV 108
                 78999*************************************************************9.***********************96 PP



Or compare VIMSS33064 to CDD or PaperBLAST