PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS536722 to PF05305 (DUF732)

VIMSS536722 has 114 amino acids

Query:       DUF732  [M=95]
Accession:   PF05305.14
Description: Protein of unknown function (DUF732)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.2e-34  103.6   2.9    3.7e-34  103.4   2.9    1.0  1  VIMSS536722  


Domain annotation for each sequence (and alignments):
>> VIMSS536722  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  103.4   2.9   3.7e-34   3.7e-34       2      94 ..       6      98 ..       5      99 .. 0.98

  Alignments for each domain:
  == domain 1  score: 103.4 bits;  conditional E-value: 3.7e-34
       DUF732  2 aaallaaalllaapAaAdsaddaFlaalnqagiaygspdaaialGkavCkkldsGksaeavvaevkndnsglspeqaaqfvgaAvsayCPeql 94
                 ++a++aa ++la pA+Ads+ddaF+a+l++agi+yg++d+a+++Gk vC +l+ Gk++++vv++++++ns+ls ++a++f+++Av+ayCP+q+
  VIMSS536722  6 IVAGFAAVIGLAVPARADSTDDAFVASLDKAGIKYGDADKAAGAGKWVCTTLQGGKQMSDVVSTLQSKNSNLSDDHANTFAAIAVNAYCPDQA 98
                 7899***************************************************************************************97 PP



Or compare VIMSS536722 to CDD or PaperBLAST