PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001116722.1 to PF05346 (DUF747)

NP_001116722.1 has 567 amino acids

Query:       DUF747  [M=319]
Accession:   PF05346.11
Description: Eukaryotic membrane protein family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   2.8e-110  354.8  20.0     4e-110  354.3  20.0    1.2  1  NP_001116722.1  


Domain annotation for each sequence (and alignments):
>> NP_001116722.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  354.3  20.0    4e-110    4e-110       1     316 [.     152     453 ..     152     456 .. 0.96

  Alignments for each domain:
  == domain 1  score: 354.3 bits;  conditional E-value: 4e-110
          DUF747   1 lspaekadllrlllilisvlllslvDtSrvYHyiRaqsfiKLyvvfnvLEvvdrLlsslgqdildalfstttlerekegeeelskllklvlqfll 95 
                     l+pa+++d+l++++++++++++++vD S++YH iR+qs+iKLy+++n+LEv+drL+ss+gqdildal++t+t+      +e++++++ ++ +f++
  NP_001116722.1 152 LQPAQVCDVLKGFIMVLCYFMMHYVDYSMMYHLIRGQSVIKLYIIYNMLEVADRLFSSFGQDILDALYWTATE-----PKERKRAHIGVIPHFFM 241
                     6899*******************************************************************93.....2246799********** PP

          DUF747  96 alayvllHslvlliqvltLnvainSsenaLltllvsnnfvEiKstVFKkfekenlfqivaaDvvERfqllllllivllrnltessseatslaevl 190
                     a++yv+lH++++++q++tLnva+nS++++Llt+++snnfvEiK++VFKkfek+nlfq++ +D+ ERf  ++llliv lrn+ ++s++ ++l+ ++
  NP_001116722.1 242 AVLYVFLHAILIMVQATTLNVAFNSHNKSLLTIMMSNNFVEIKGSVFKKFEKNNLFQMSNSDIKERFTNYTLLLIVCLRNMEQFSWNPDHLWVLF 336
                     *********************************************************************************************** PP

          DUF747 191 splllvlllEvlVDwvKhayllKFNnikpsvyeeyldvllkDvllsrtkqaqaevpckafvafshiltrrlGfmelplvtliirvlpqvlsllll 285
                      ++++v+++E++VD+vKha+++KFN+i ++vy+ey  +l+ D+++sr+k+        a+++ s+ ++rr+Gf++lpl+ l+irv++  +++   
  NP_001116722.1 337 PDVCMVIASEIAVDVVKHAFITKFNDITADVYSEYRASLAFDLVSSRQKN--------AYTDYSDSVSRRMGFIPLPLALLLIRVVTSSVKIQG- 422
                     **********************************************9997........899********************************9. PP

          DUF747 286 lstlvlalliwlvLlllkvllsllllkfaik 316
                       ++v++ll++l +++lkvl+s++ll+ ++ 
  NP_001116722.1 423 SLSIVCVLLFYLGMITLKVLNSIVLLGKSCM 453
                     6778888888***************998875 PP



Or compare NP_001116722.1 to CDD or PaperBLAST