PaperBLAST – Find papers about a protein or its homologs

 

Align NP_176963.2 to PF05346 (DUF747)

NP_176963.2 has 624 amino acids

Query:       DUF747  [M=319]
Accession:   PF05346.11
Description: Eukaryotic membrane protein family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.8e-90  288.6   8.2    6.5e-90  287.9   8.2    1.3  1  NP_176963.2  


Domain annotation for each sequence (and alignments):
>> NP_176963.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  287.9   8.2   6.5e-90   6.5e-90       3     317 ..     305     609 ..     303     611 .. 0.95

  Alignments for each domain:
  == domain 1  score: 287.9 bits;  conditional E-value: 6.5e-90
       DUF747   3 paekadllrlllilisvlllslvDtSrvYHyiRaqsfiKLyvvfnvLEvvdrLlsslgqdildalfsttt..lerekegeeelskllklvlqfllala 98 
                  ++e++dl ++l++ + ++ll ++D+S +YH+iR+qs+iKLyvv+n+LE++drL++s++ d++ alfs+++  +   +  e+ + +++++v +++l++a
  NP_176963.2 305 ASELSDLACFLVLATGTILLGRTDISLIYHMIRGQSTIKLYVVYNILEIFDRLCQSFCGDVFGALFSSAKglS--ISPPEKLRFSTWRFVSDLALTMA 400
                  67899****************************************************************9641..333334568999*********** PP

       DUF747  99 yvllHslvlliqvltLnvainSsenaLltllvsnnfvEiKstVFKkfekenlfqivaaDvvERfqllllllivllrnltessseatslaevlsplllv 196
                    +lHs++ll q++tL+ +i +++naLl+llvsnnf+EiKs+VFK+f+k+n++ +v+aD +ERf+++ +l+ vl +n+ e  se  ++++++ + ++v
  NP_176963.2 401 ASILHSFILLAQAITLSTCIVAHNNALLALLVSNNFAEIKSSVFKRFSKDNIHGLVYADSIERFHISAFLVSVLAQNILE--SEGAWFGNFIYNATTV 496
                  ********************************************************************************..799************* PP

       DUF747 197 lllEvlVDwvKhayllKFNnikpsvyeeyldvllkDvllsrtkqaqaevpckafvafshiltrrlGfmelplvtliirvlpqvlslll........ll 286
                  +++E+++D++Kh++l+KFN+ikp +y+e+l+ l++++l+ r +                  +  l+f++l+ ++++irvl++v+  +l        +l
  NP_176963.2 497 FFCEMMIDIIKHSFLAKFNDIKPIAYSEFLQALCEQTLNIRPED----------------RKTNLTFVPLAPACVVIRVLTPVYAAHLpysplpwrML 578
                  *************************************9985553................45789**********************9********99 PP

       DUF747 287 stlvlalliwlvLlllkvllsllllkfaikr 317
                  ++++l+++++++L+ lkvl+++ l k+a+++
  NP_176963.2 579 WMVILFVITYIMLTSLKVLIGMGLRKHATWY 609
                  ***************************9975 PP



Or compare NP_176963.2 to CDD or PaperBLAST