PaperBLAST – Find papers about a protein or its homologs

 

Align NP_699196.2 to PF05346 (DUF747)

NP_699196.2 has 567 amino acids

Query:       DUF747  [M=319]
Accession:   PF05346.11
Description: Eukaryotic membrane protein family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
     5e-112  360.5  19.2   6.5e-112  360.1  19.2    1.1  1  NP_699196.2  


Domain annotation for each sequence (and alignments):
>> NP_699196.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  360.1  19.2  6.5e-112  6.5e-112       1     317 [.     155     457 ..     155     459 .. 0.96

  Alignments for each domain:
  == domain 1  score: 360.1 bits;  conditional E-value: 6.5e-112
       DUF747   1 lspaekadllrlllilisvlllslvDtSrvYHyiRaqsfiKLyvvfnvLEvvdrLlsslgqdildalfstttlerekegeeelskllklvlqfllala 98 
                  l+pa+++d+l++++++i+++++++vD S++YH iR+qs+iKLy+++n+LEv+drL+ss+gqdildal++t+t+      +e++++++ ++ +f++a++
  NP_699196.2 155 LQPAQVCDILKGVILVICYFMMHYVDYSMMYHLIRGQSVIKLYIIYNMLEVADRLFSSFGQDILDALYWTATE-----PKERKRAHIGVIPHFFMAVL 247
                  6899*******************************************************************93.....2246799************* PP

       DUF747  99 yvllHslvlliqvltLnvainSsenaLltllvsnnfvEiKstVFKkfekenlfqivaaDvvERfqllllllivllrnltessseatslaevlsplllv 196
                  yv+lH++++++q++tLnva+nS++++Llt+++snnfvEiK++VFKkfek+nlfq++ +D+ ERf  ++llliv lrn+ ++s++ ++l+ ++ ++++v
  NP_699196.2 248 YVFLHAILIMVQATTLNVAFNSHNKSLLTIMMSNNFVEIKGSVFKKFEKNNLFQMSNSDIKERFTNYVLLLIVCLRNMEQFSWNPDHLWVLFPDVCMV 345
                  ************************************************************************************************** PP

       DUF747 197 lllEvlVDwvKhayllKFNnikpsvyeeyldvllkDvllsrtkqaqaevpckafvafshiltrrlGfmelplvtliirvlpqvlslllllstlvlall 294
                  +++E++VD+vKha+++KFN+i ++vy+ey  +l+ D+++sr+k+        a+++ s+ ++rr+Gf++lpl++l+irv++  +++   + ++++++l
  NP_699196.2 346 IASEIAVDIVKHAFITKFNDITADVYSEYRASLAFDLVSSRQKN--------AYTDYSDSVARRMGFIPLPLAVLLIRVVTSSIKVQG-ILSYACVIL 434
                  ****************************************9997........899*********************************.777778888 PP

       DUF747 295 iwlvLlllkvllsllllkfaikr 317
                  +++ L+ lkvl+s++ll+ ++++
  NP_699196.2 435 FYFGLISLKVLNSIVLLGKSCQY 457
                  899**************999886 PP



Or compare NP_699196.2 to CDD or PaperBLAST