PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::O60067 to PF05346 (DUF747)

SwissProt::O60067 has 649 amino acids

Query:       DUF747  [M=319]
Accession:   PF05346.11
Description: Eukaryotic membrane protein family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
   1.9e-108  348.7  17.2   2.6e-108  348.3  17.2    1.2  1  SwissProt::O60067  


Domain annotation for each sequence (and alignments):
>> SwissProt::O60067  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  348.3  17.2  2.6e-108  2.6e-108       3     318 ..     220     584 ..     218     585 .. 0.96

  Alignments for each domain:
  == domain 1  score: 348.3 bits;  conditional E-value: 2.6e-108
             DUF747   3 paekadllrlllilisvlllslvDtSrvYHyiRaqsfiKLyvvfnvLEvvdrLlsslgqdildalfstttlerekegeeelskllklvlqfl 94 
                        +++k dll+llli+ +++l+ ++D+Sr+YH iRaq+ i++yv++nvLE++drL+++lgqd+ld+lfs+ +l+ +  +      +++++ +f+
  SwissProt::O60067 220 RSRKIDLLKLLLIFSTSILIRKIDVSRLYHIIRAQASIRFYVLYNVLEIADRLCCALGQDVLDCLFSNHILSFNFWN---PAGWMTFFYYFA 308
                        57899*****************************************************************9888877...579********* PP

             DUF747  95 lalayvllHslvlliqvltLnvainSsenaLltllvsnnfvEiKstVFKkfekenlfqivaaDvvERfqllllllivllrnlte........ 178
                        ++lay++lH+lvll+q++tLnv++nS++na l+ll+sn+ vEiK++VFKkfekenlfq++++DvvERfq++++++i++lrnl e        
  SwissProt::O60067 309 ISLAYMVLHTLVLLYQIITLNVTVNSYSNAVLALLMSNQLVEIKGAVFKKFEKENLFQLTCSDVVERFQITIMVIIIFLRNLAElyttssld 400
                        ***************************************************************************************99999 PP

             DUF747 179 .ssseatslaevlsplllvlllEvlVDwvKhayllKFNnikpsvyeeyldvllkDvllsrtkqaqaevpckafvafshiltrrlGfmelplv 269
                            + + l+++l+p+++v+++E++VDw+Kha+++KFN ikps+y++++dvl++D++ s  +       +++++  s++++rr+G+++lplv
  SwissProt::O60067 401 qPLLTFKRLKTLLAPFFWVIGSELFVDWLKHAFIIKFNYIKPSIYSRFTDVLCHDYVASGAQ------LTQTVTGCSQQVARRMGLPVLPLV 486
                        85568899**************************************************9666......46789999999************* PP

             DUF747 270 tliirvlpqvlslll.................................................llstlvlalliwlvLlllkvllsllllk 312
                        +++ir+++q++s++                                                  ++   + +++++++ ++lk+ll+ ++l+
  SwissProt::O60067 487 CVFIRTSMQTWSMFRsthsmkqeiaksigtifptkdnyvyylpnkeantynagkeaswetlllsVVRGKSGIAFLFFMAIMLKLLLGKAILA 578
                        ************************************************************99997788888888899999************ PP

             DUF747 313 faikrk 318
                        ++ +r+
  SwissProt::O60067 579 ITQSRY 584
                        999987 PP



Or compare SwissProt::O60067 to CDD or PaperBLAST