PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q4VBD2 to PF05346 (DUF747)

SwissProt::Q4VBD2 has 564 amino acids

Query:       DUF747  [M=319]
Accession:   PF05346.11
Description: Eukaryotic membrane protein family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
     5e-112  360.5  19.2   6.5e-112  360.1  19.2    1.1  1  SwissProt::Q4VBD2  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q4VBD2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  360.1  19.2  6.5e-112  6.5e-112       1     317 [.     152     454 ..     152     456 .. 0.96

  Alignments for each domain:
  == domain 1  score: 360.1 bits;  conditional E-value: 6.5e-112
             DUF747   1 lspaekadllrlllilisvlllslvDtSrvYHyiRaqsfiKLyvvfnvLEvvdrLlsslgqdildalfstttlerekegeeelskllklvlq 92 
                        l+pa+++d+l++++++i+++++++vD S++YH iR+qs+iKLy+++n+LEv+drL+ss+gqdildal++t+t+      +e++++++ ++ +
  SwissProt::Q4VBD2 152 LQPAQVCDILKGVILVICYFMMHYVDYSMMYHLIRGQSVIKLYIIYNMLEVADRLFSSFGQDILDALYWTATE-----PKERKRAHIGVIPH 238
                        6899*******************************************************************93.....2246799******* PP

             DUF747  93 fllalayvllHslvlliqvltLnvainSsenaLltllvsnnfvEiKstVFKkfekenlfqivaaDvvERfqllllllivllrnltessseat 184
                        f++a++yv+lH++++++q++tLnva+nS++++Llt+++snnfvEiK++VFKkfek+nlfq++ +D+ ERf  ++llliv lrn+ ++s++ +
  SwissProt::Q4VBD2 239 FFMAVLYVFLHAILIMVQATTLNVAFNSHNKSLLTIMMSNNFVEIKGSVFKKFEKNNLFQMSNSDIKERFTNYVLLLIVCLRNMEQFSWNPD 330
                        ******************************************************************************************** PP

             DUF747 185 slaevlsplllvlllEvlVDwvKhayllKFNnikpsvyeeyldvllkDvllsrtkqaqaevpckafvafshiltrrlGfmelplvtliirvl 276
                        +l+ ++ ++++v+++E++VD+vKha+++KFN+i ++vy+ey  +l+ D+++sr+k+        a+++ s+ ++rr+Gf++lpl++l+irv+
  SwissProt::Q4VBD2 331 HLWVLFPDVCMVIASEIAVDIVKHAFITKFNDITADVYSEYRASLAFDLVSSRQKN--------AYTDYSDSVARRMGFIPLPLAVLLIRVV 414
                        ****************************************************9997........899************************* PP

             DUF747 277 pqvlslllllstlvlalliwlvLlllkvllsllllkfaikr 317
                        +  +++   + ++++++l+++ L+ lk+l+s++ll+ ++++
  SwissProt::Q4VBD2 415 TSSIKVQG-ILSYACVILFYFGLISLKILNSIVLLGKSCQY 454
                        ********.777778888899**************999886 PP



Or compare SwissProt::Q4VBD2 to CDD or PaperBLAST