PaperBLAST – Find papers about a protein or its homologs

 

Align XP_002144905.1 to PF05346 (DUF747)

XP_002144905.1 has 1039 amino acids

Query:       DUF747  [M=319]
Accession:   PF05346.11
Description: Eukaryotic membrane protein family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   1.8e-123  398.1   9.9   2.4e-123  397.7   9.9    1.2  1  XP_002144905.1  


Domain annotation for each sequence (and alignments):
>> XP_002144905.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  397.7   9.9  2.4e-123  2.4e-123       2     319 .]     500     926 ..     499     926 .. 0.99

  Alignments for each domain:
  == domain 1  score: 397.7 bits;  conditional E-value: 2.4e-123
          DUF747   2 spaekadllrlllilisvlllslvDtSrvYHyiRaqsfiKLyvvfnvLEvvdrLlsslgqdildalfstttlerekegeeelskllklvlqflla 96 
                     +p +kad+l+++l+++++++ls++D+Sr+YH+iR+q++iKLyv++nvLEv drLls++gqd+l++lfs+++l+r  +g   +sk++++++ flla
  XP_002144905.1 500 EPDDKADILKGFLMICTCIILSSLDASRMYHWIRGQNAIKLYVIYNVLEVGDRLLSAIGQDVLECLFSKEALDRGLDG---RSKVVRPFWLFLLA 591
                     6889*******************************************************************9999999...7************* PP

          DUF747  97 layvllHslvlliqvltLnvainSsenaLltllvsnnfvEiKstVFKkfekenlfqivaaDvvERfqllllllivllrnlte............. 178
                     lay+++H+++l++qv+tLnva+nS++naL+tll+sn+fvEiKstVFKkfekenlfq+++aDvvERfql+l+l+i++ rn++e             
  XP_002144905.1 592 LAYTTTHATALFYQVITLNVAVNSYSNALITLLLSNQFVEIKSTVFKKFEKENLFQLTCADVVERFQLWLMLTIIASRNIVEtgaftswfavgss 686
                     *********************************************************************************************** PP

          DUF747 179 ............................................ssseatslaevlsplllvlllEvlVDwvKhayllKFNnikpsvyeeyldvl 229
                                                                 +++   ++a+vl p+l+vl++E++VDw+Khay++KFNn +p++y ++ldvl
  XP_002144905.1 687 vtnqvrstvtnstplttsphsstsilpksftflpstiftsltggANTLLPHFAQVLGPFLIVLGSEMFVDWLKHAYIAKFNNTRPAIYGRFLDVL 781
                     ********************************************9999*********************************************** PP

          DUF747 230 lkDvllsrtkqaqaevpckafvafshiltrrlGfmelplvtliirvlpqvlslll........................................ 284
                      kD++++            afv+++  lt+rlG++++p+++l++rv++q+++++l                                        
  XP_002144905.1 782 TKDYYTN------------AFVDQN--LTKRLGLAVIPMACLFFRVSVQTYQMFLqallptqasatehsasltaihehysnlpqpsspsmpftvq 862
                     ******9............99**99..******************************************************************** PP

          DUF747 285 .............................llstlvlalliwlvLlllkvllsllllkfaikrkk 319
                                                  ++ t+vl++ ++l+Ll++k++l++lll+f+++r+k
  XP_002144905.1 863 svmstsldrlswvfntivenaipspiqsvTFFTIVLVVTAYLILLIFKLTLGILLLSFSRSRYK 926
                     ***************************9988899999999********************9986 PP



Or compare XP_002144905.1 to CDD or PaperBLAST