PaperBLAST – Find papers about a protein or its homologs

 

Align XP_002340488.1 to PF05346 (DUF747)

XP_002340488.1 has 1008 amino acids

Query:       DUF747  [M=319]
Accession:   PF05346.11
Description: Eukaryotic membrane protein family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   3.5e-124  400.4   7.9   4.9e-124  400.0   7.9    1.2  1  XP_002340488.1  


Domain annotation for each sequence (and alignments):
>> XP_002340488.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  400.0   7.9  4.9e-124  4.9e-124       2     319 .]     465     891 ..     464     891 .. 0.99

  Alignments for each domain:
  == domain 1  score: 400.0 bits;  conditional E-value: 4.9e-124
          DUF747   2 spaekadllrlllilisvlllslvDtSrvYHyiRaqsfiKLyvvfnvLEvvdrLlsslgqdildalfstttlerekegeeelskllklvlqflla 96 
                     ++ +kad+l+++li++++++ls++D+Sr+YH+iR+q++iKLyv++nvLEv drLls++gqd+l++lfs+++l+r k+g   +sk++++++ f la
  XP_002340488.1 465 ESDDKADILKGSLIICTCIVLSYFDASRMYHWIRGQNAIKLYVIYNVLEVGDRLLSAIGQDVLECLFSQEALDRGKDG---RSKVVRPFWLFWLA 556
                     67899*******************************************************************999999...7************* PP

          DUF747  97 layvllHslvlliqvltLnvainSsenaLltllvsnnfvEiKstVFKkfekenlfqivaaDvvERfqllllllivllrnlte............. 178
                     lay+++H+++l++qv+tLnva+nS++naL+tll+sn+fvEiKstVFKkfekenlfq+++aDvvERfql+l+l+i++ rn++e             
  XP_002340488.1 557 LAYTTVHATALFYQVVTLNVAVNSYSNALITLLLSNQFVEIKSTVFKKFEKENLFQLTCADVVERFQLWLMLTIIASRNIVEtgaftswftvgqg 651
                     *********************************************************************************************** PP

          DUF747 179 ............................................ssseatslaevlsplllvlllEvlVDwvKhayllKFNnikpsvyeeyldvl 229
                                                                 +++   +la+vl p+l+vl++E++VDw+Khay++KFNn +p++y ++ldvl
  XP_002340488.1 652 vsdqirssvtnstplttsprsstsilpqsftflpstfftsltggANTLLPQLAQVLGPFLIVLGSEMFVDWLKHAYIAKFNNTRPAIYGRFLDVL 746
                     ********************************************99999********************************************** PP

          DUF747 230 lkDvllsrtkqaqaevpckafvafshiltrrlGfmelplvtliirvlpqvlslll........................................ 284
                     +kD++++            af++++  lt+rlG++++p+++l++rv++q+++++l                                        
  XP_002340488.1 747 AKDYYTN------------AFIDQN--LTKRLGLAVIPMACLFFRVSVQTYQMFLqallpmqasstehsasltamhehysnlpqpssptlpltvq 827
                     ******9............899999..******************************************************************** PP

          DUF747 285 .............................llstlvlalliwlvLlllkvllsllllkfaikrkk 319
                                                  ++ t+vl+l ++l+Ll++k++l++lll+f+++r+k
  XP_002340488.1 828 svmsnsfdrlswlfntivenaipspiqsvTFFTIVLVLTGYLILLIFKLTLGILLLTFSRSRYK 891
                     ***************************998899999999*********************9986 PP



Or compare XP_002340488.1 to CDD or PaperBLAST