PaperBLAST – Find papers about a protein or its homologs

 

Align XP_006504002.1 to PF05346 (DUF747)

XP_006504002.1 has 636 amino acids

Query:       DUF747  [M=319]
Accession:   PF05346.11
Description: Eukaryotic membrane protein family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   7.5e-112  359.9  19.2   8.8e-112  359.7  19.2    1.0  1  XP_006504002.1  


Domain annotation for each sequence (and alignments):
>> XP_006504002.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  359.7  19.2  8.8e-112  8.8e-112       1     317 [.     224     526 ..     224     528 .. 0.96

  Alignments for each domain:
  == domain 1  score: 359.7 bits;  conditional E-value: 8.8e-112
          DUF747   1 lspaekadllrlllilisvlllslvDtSrvYHyiRaqsfiKLyvvfnvLEvvdrLlsslgqdildalfstttlerekegeeelskllklvlqfll 95 
                     l+pa+++d+l++++++i+++++++vD S++YH iR+qs+iKLy+++n+LEv+drL+ss+gqdildal++t+t+      +e++++++ ++ +f++
  XP_006504002.1 224 LQPAQVCDILKGVILVICYFMMHYVDYSMMYHLIRGQSVIKLYIIYNMLEVADRLFSSFGQDILDALYWTATE-----PKERKRAHIGVIPHFFM 313
                     6899*******************************************************************93.....2246799********** PP

          DUF747  96 alayvllHslvlliqvltLnvainSsenaLltllvsnnfvEiKstVFKkfekenlfqivaaDvvERfqllllllivllrnltessseatslaevl 190
                     a++yv+lH++++++q++tLnva+nS++++Llt+++snnfvEiK++VFKkfek+nlfq++ +D+ ERf  ++llliv lrn+ ++s++ ++l+ ++
  XP_006504002.1 314 AVLYVFLHAILIMVQATTLNVAFNSHNKSLLTIMMSNNFVEIKGSVFKKFEKNNLFQMSNSDIKERFTNYVLLLIVCLRNMEQFSWNPDHLWVLF 408
                     *********************************************************************************************** PP

          DUF747 191 splllvlllEvlVDwvKhayllKFNnikpsvyeeyldvllkDvllsrtkqaqaevpckafvafshiltrrlGfmelplvtliirvlpqvlsllll 285
                      ++++v+++E++VD+vKha+++KFN+i ++vy+ey  +l+ D+++sr+k+        a+++ s+ ++rr+Gf++lpl++l+irv++  +++   
  XP_006504002.1 409 PDVCMVIASEIAVDIVKHAFITKFNDITADVYSEYRASLAFDLVSSRQKN--------AYTDYSDSVARRMGFIPLPLAVLLIRVVTSSIKVQG- 494
                     **********************************************9997........899*********************************. PP

          DUF747 286 lstlvlalliwlvLlllkvllsllllkfaikr 317
                     + ++++++l+++ L+ lk+l+s++ll+ ++++
  XP_006504002.1 495 ILSYACVILFYFGLISLKILNSIVLLGKSCQY 526
                     777778888899**************999886 PP



Or compare XP_006504002.1 to CDD or PaperBLAST