PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001028707.1 to PF05527 (DUF758)

NP_001028707.1 has 204 amino acids

Query:       DUF758  [M=181]
Accession:   PF05527.11
Description: Domain of unknown function (DUF758)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.9e-79  252.0   6.8    2.1e-79  251.9   6.8    1.0  1  NP_001028707.1  


Domain annotation for each sequence (and alignments):
>> NP_001028707.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  251.9   6.8   2.1e-79   2.1e-79       1     180 [.      22     201 ..      22     202 .. 0.99

  Alignments for each domain:
  == domain 1  score: 251.9 bits;  conditional E-value: 2.1e-79
          DUF758   1 FsskdlalraqKkllgkmasksvaklfiddtsselldelykllkeytgnkkeaekvvKniiKvvvKvgvllrnkqlsaeelallekfrkklrtla 95 
                     Fssk+lal+aqKk+l+k+ask+va+++iddtsse++delyk+++ +t+nkkea+k++K++iKv++K+g+l+rnkq+s+ee+  +ek+rkkl+++a
  NP_001028707.1  22 FSSKNLALQAQKKILSKIASKTVANMLIDDTSSEIFDELYKVTEIHTHNKKEAHKIMKDAIKVAIKIGILYRNKQFSQEEVIIVEKLRKKLNQTA 116
                     99********************************************************************************************* PP

          DUF758  96 mtlisfyevdftfdkavLadlLkecrellkqlverhLtdkslgridhvfdflsdpefldalfspdseyrellkkivddLnkllde 180
                     mt++sfyev++tfd +vL++lL+ec++l+++lv+rhLt++++gri+hvf++++d efl++l+ p +++r++lk+i++++nklld+
  NP_001028707.1 117 MTMVSFYEVEYTFDTNVLSKLLHECKDLVHELVQRHLTPRTHGRINHVFNHFADVEFLSTLYGPHGNCRPNLKRICEGINKLLDD 201
                     ***********************************************************************************97 PP



Or compare NP_001028707.1 to CDD or PaperBLAST