PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001161414.1 to PF05527 (DUF758)

NP_001161414.1 has 186 amino acids

Query:       DUF758  [M=181]
Accession:   PF05527.11
Description: Domain of unknown function (DUF758)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.9e-75  238.9   0.0    2.2e-75  238.8   0.0    1.0  1  NP_001161414.1  


Domain annotation for each sequence (and alignments):
>> NP_001161414.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  238.8   0.0   2.2e-75   2.2e-75       1     181 []       4     184 ..       4     184 .. 1.00

  Alignments for each domain:
  == domain 1  score: 238.8 bits;  conditional E-value: 2.2e-75
          DUF758   1 FsskdlalraqKkllgkmasksvaklfiddtsselldelykllkeytgnkkeaekvvKniiKvvvKvgvllrnkqlsaeelallekfrkklrtla 95 
                     Fs+k+lal+aqKkll+kmask v+++++ddtsse+ldely+ ++e+t+++kea+k++Kn++Kv+ K+g+llr +ql  eelall++fr+++r la
  NP_001161414.1   4 FSTKSLALQAQKKLLSKMASKAVVAVLVDDTSSEVLDELYRATREFTRSRKEAQKMLKNLVKVALKLGLLLRGDQLGGEELALLRRFRHRARCLA 98 
                     89********************************************************************************************* PP

          DUF758  96 mtlisfyevdftfdkavLadlLkecrellkqlverhLtdkslgridhvfdflsdpefldalfspdseyrellkkivddLnklldeg 181
                     mt++sf++vdftfd++vLa+ L ecr+ll+q+v +hLt+ks+gri+hvf +l+d +fl+al+ p+++yr++l++i+++L ++ldeg
  NP_001161414.1  99 MTAVSFHQVDFTFDRRVLAAGLLECRDLLHQAVGPHLTAKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEG 184
                     ************************************************************************************97 PP



Or compare NP_001161414.1 to CDD or PaperBLAST