PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001171230.1 to PF05527 (DUF758)

NP_001171230.1 has 188 amino acids

Query:       DUF758  [M=181]
Accession:   PF05527.11
Description: Domain of unknown function (DUF758)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.1e-82  261.6   9.5    2.4e-82  261.4   9.5    1.0  1  NP_001171230.1  


Domain annotation for each sequence (and alignments):
>> NP_001171230.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  261.4   9.5   2.4e-82   2.4e-82       1     180 [.       6     185 ..       6     186 .. 0.99

  Alignments for each domain:
  == domain 1  score: 261.4 bits;  conditional E-value: 2.4e-82
          DUF758   1 FsskdlalraqKkllgkmasksvaklfiddtsselldelykllkeytgnkkeaekvvKniiKvvvKvgvllrnkqlsaeelallekfrkklrtla 95 
                     F+sk+la++aqKk+lgkm+sks+a+++iddtsse+ldely+++keyt+nkkeae+v+Kn+iK+v+K++vl+rn+q++++elal+ekf+kk+++la
  NP_001171230.1   6 FNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTKEYTQNKKEAERVIKNLIKTVIKLAVLHRNNQFNQDELALMEKFKKKVHQLA 100
                     99********************************************************************************************* PP

          DUF758  96 mtlisfyevdftfdkavLadlLkecrellkqlverhLtdkslgridhvfdflsdpefldalfspdseyrellkkivddLnkllde 180
                     mt++sf++v++tfd++vL++lL+ecrell+++++rhLt+ks+gr+++vfd++sd +fl+al++p ++++++l+k++d++nk+lde
  NP_001171230.1 101 MTVVSFHQVEYTFDRNVLSRLLNECRELLHEIIQRHLTAKSHGRVNNVFDHFSDCDFLAALYNPFGKFKPHLQKLCDGINKMLDE 185
                     ************************************************************************************8 PP



Or compare NP_001171230.1 to CDD or PaperBLAST