PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001273746.1 to PF05527 (DUF758)

NP_001273746.1 has 166 amino acids

Query:       DUF758  [M=181]
Accession:   PF05527.11
Description: Domain of unknown function (DUF758)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.8e-74  234.7   7.0    4.3e-74  234.6   7.0    1.0  1  NP_001273746.1  


Domain annotation for each sequence (and alignments):
>> NP_001273746.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  234.6   7.0   4.3e-74   4.3e-74      18     180 ..       1     163 [.       1     164 [. 0.99

  Alignments for each domain:
  == domain 1  score: 234.6 bits;  conditional E-value: 4.3e-74
          DUF758  18 masksvaklfiddtsselldelykllkeytgnkkeaekvvKniiKvvvKvgvllrnkqlsaeelallekfrkklrtlamtlisfyevdftfdkav 112
                     m+sks+a+++iddtsse+ldely++++eyt+nkkeaek++Kn+iK+v+K+++l+rn+q++++elal+ekf+kk+++lamt++sf++vd+tfd++v
  NP_001273746.1   1 MVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNV 95 
                     89********************************************************************************************* PP

          DUF758 113 LadlLkecrellkqlverhLtdkslgridhvfdflsdpefldalfspdseyrellkkivddLnkllde 180
                     L++lL+ecre+l+q+++rhLt+ks+gr+++vfd++sd efl+al++p ++++++l+k++d++nk+lde
  NP_001273746.1  96 LSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDE 163
                     *******************************************************************8 PP



Or compare NP_001273746.1 to CDD or PaperBLAST