PaperBLAST – Find papers about a protein or its homologs

 

Align NP_078851.2 to PF05527 (DUF758)

NP_078851.2 has 184 amino acids

Query:       DUF758  [M=181]
Accession:   PF05527.11
Description: Domain of unknown function (DUF758)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.8e-78  247.8   0.0    4.2e-78  247.6   0.0    1.0  1  NP_078851.2  


Domain annotation for each sequence (and alignments):
>> NP_078851.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  247.6   0.0   4.2e-78   4.2e-78       1     181 []       4     182 ..       4     182 .. 0.99

  Alignments for each domain:
  == domain 1  score: 247.6 bits;  conditional E-value: 4.2e-78
       DUF758   1 FsskdlalraqKkllgkmasksvaklfiddtsselldelykllkeytgnkkeaekvvKniiKvvvKvgvllrnkqlsaeelallekfrkklrtlamtl 98 
                  Fssk+lal+a+Kkll+kma++sva+lfid+tsse+ldely+++keyt+++ +a++v+K++iKv++Kv+vl+rn+ + ++elal+++fr+klr+ amt+
  NP_078851.2   4 FSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTA 101
                  99************************************************************************************************ PP

       DUF758  99 isfyevdftfdkavLadlLkecrellkqlverhLtdkslgridhvfdflsdpefldalfspdseyrellkkivddLnklldeg 181
                  +sf evdftf++avLa lL+ecr++l++lve+hLt+ks+gri+hvfd++sdp +l+al+ pd  + ++l+ki+d+L+klldeg
  NP_078851.2 102 LSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPD--FTQHLGKICDGLRKLLDEG 182
                  ***********************************************************666..*****************97 PP



Or compare NP_078851.2 to CDD or PaperBLAST