PaperBLAST – Find papers about a protein or its homologs

 

Align NP_079842.2 to PF05527 (DUF758)

NP_079842.2 has 186 amino acids

Query:       DUF758  [M=181]
Accession:   PF05527.11
Description: Domain of unknown function (DUF758)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.3e-76  242.8   0.2    1.4e-76  242.6   0.2    1.0  1  NP_079842.2  


Domain annotation for each sequence (and alignments):
>> NP_079842.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  242.6   0.2   1.4e-76   1.4e-76       1     181 []       4     184 ..       4     184 .. 1.00

  Alignments for each domain:
  == domain 1  score: 242.6 bits;  conditional E-value: 1.4e-76
       DUF758   1 FsskdlalraqKkllgkmasksvaklfiddtsselldelykllkeytgnkkeaekvvKniiKvvvKvgvllrnkqlsaeelallekfrkklrtlamtl 98 
                  Fs+k+lal+aqKk+l+kmask ++++f+d+tsse+ldely+ +ke+t+++kea++vvKn++Kv+vK++vllr +ql+++ela+l++fr ++r+lamt+
  NP_079842.2   4 FSTKSLALQAQKKVLSKMASKAMVAVFVDNTSSEVLDELYQATKEFTRSRKEAQRVVKNLVKVAVKLAVLLRADQLDSNELAQLQRFRGRVRSLAMTA 101
                  89************************************************************************************************ PP

       DUF758  99 isfyevdftfdkavLadlLkecrellkqlverhLtdkslgridhvfdflsdpefldalfspdseyrellkkivddLnklldeg 181
                  +sf++vdftfd++vLa+ L ecr+ll+q++ +hLt+ks+gri+h+f+++++++fl+al+sp+++yr++l +i+d+L ++ldeg
  NP_079842.2 102 LSFHQVDFTFDRRVLATGLLECRDLLHQAIGPHLTAKSHGRINHIFSHFANGDFLAALYSPAEPYRSHLCRICDGLGRMLDEG 184
                  *********************************************************************************97 PP



Or compare NP_079842.2 to CDD or PaperBLAST