PaperBLAST – Find papers about a protein or its homologs

 

Align NP_997264.2 to PF05527 (DUF758)

NP_997264.2 has 292 amino acids

Query:       DUF758  [M=181]
Accession:   PF05527.11
Description: Domain of unknown function (DUF758)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.7e-81  258.7   8.5      2e-81  258.5   8.5    1.1  1  NP_997264.2  


Domain annotation for each sequence (and alignments):
>> NP_997264.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  258.5   8.5     2e-81     2e-81       1     180 [.     110     289 ..     110     290 .. 0.99

  Alignments for each domain:
  == domain 1  score: 258.5 bits;  conditional E-value: 2e-81
       DUF758   1 FsskdlalraqKkllgkmasksvaklfiddtsselldelykllkeytgnkkeaekvvKniiKvvvKvgvllrnkqlsaeelallekfrkklrtlamtl 98 
                  Fssk+lal+aqKk+l+k+ask+va+++iddtsse++delyk++ke+t+nkkea+k++K++iKv++K+g+l+rn+q+s+eel  +ekfrkkl+++amt+
  NP_997264.2 110 FSSKSLALQAQKKILSKIASKTVANMLIDDTSSEIFDELYKVTKEHTHNKKEAHKIMKDLIKVAIKIGILYRNNQFSQEELVIVEKFRKKLNQTAMTI 207
                  99************************************************************************************************ PP

       DUF758  99 isfyevdftfdkavLadlLkecrellkqlverhLtdkslgridhvfdflsdpefldalfspdseyrellkkivddLnkllde 180
                  +sfyev++tfd++vL++lL+ec++l+++lv+rhLt++++gri+hvf++++d efl++l+s d+++r++lk+i++++nkllde
  NP_997264.2 208 VSFYEVEYTFDRNVLSNLLHECKDLVHELVQRHLTPRTHGRINHVFNHFADVEFLSTLYSLDGDCRPNLKRICEGINKLLDE 289
                  *********************************************************************************8 PP



Or compare NP_997264.2 to CDD or PaperBLAST