PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::O95379 to PF05527 (DUF758)

SwissProt::O95379 has 198 amino acids

Query:       DUF758  [M=181]
Accession:   PF05527.11
Description: Domain of unknown function (DUF758)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.7e-83  265.2   9.2      2e-83  265.0   9.2    1.0  1  SwissProt::O95379  


Domain annotation for each sequence (and alignments):
>> SwissProt::O95379  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  265.0   9.2     2e-83     2e-83       1     180 [.      16     195 ..      16     196 .. 0.99

  Alignments for each domain:
  == domain 1  score: 265.0 bits;  conditional E-value: 2e-83
             DUF758   1 FsskdlalraqKkllgkmasksvaklfiddtsselldelykllkeytgnkkeaekvvKniiKvvvKvgvllrnkqlsaeelallekfrkklr 92 
                        F+sk+la++aqKk+lgkm+sks+a+++iddtsse+ldely++++eyt+nkkeaek++Kn+iK+v+K+++l+rn+q++++elal+ekf+kk++
  SwissProt::O95379  16 FNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVH 107
                        99****************************************************************************************** PP

             DUF758  93 tlamtlisfyevdftfdkavLadlLkecrellkqlverhLtdkslgridhvfdflsdpefldalfspdseyrellkkivddLnkllde 180
                        +lamt++sf++vd+tfd++vL++lL+ecre+l+q+++rhLt+ks+gr+++vfd++sd efl+al++p ++++++l+k++d++nk+lde
  SwissProt::O95379 108 QLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDE 195
                        ***************************************************************************************8 PP



Or compare SwissProt::O95379 to CDD or PaperBLAST