PaperBLAST – Find papers about a protein or its homologs

 

Align XP_006254771.1 to PF05527 (DUF758)

XP_006254771.1 has 188 amino acids

Query:       DUF758  [M=181]
Accession:   PF05527.11
Description: Domain of unknown function (DUF758)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    8.8e-83  262.9   9.4    9.8e-83  262.7   9.4    1.0  1  XP_006254771.1  


Domain annotation for each sequence (and alignments):
>> XP_006254771.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  262.7   9.4   9.8e-83   9.8e-83       1     180 [.       6     185 ..       6     186 .. 0.99

  Alignments for each domain:
  == domain 1  score: 262.7 bits;  conditional E-value: 9.8e-83
          DUF758   1 FsskdlalraqKkllgkmasksvaklfiddtsselldelykllkeytgnkkeaekvvKniiKvvvKvgvllrnkqlsaeelallekfrkklrtla 95 
                     F+sk+la++aqKk+lgkm+sks+a+++iddtsse+ldely+++keyt+nkkeaekv+Kn+iK+v+K++vl+rn+q++++elal+ekf++k+++la
  XP_006254771.1   6 FNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTKEYTQNKKEAEKVIKNLIKTVIKLAVLHRNNQFNQDELALMEKFKRKVHQLA 100
                     99********************************************************************************************* PP

          DUF758  96 mtlisfyevdftfdkavLadlLkecrellkqlverhLtdkslgridhvfdflsdpefldalfspdseyrellkkivddLnkllde 180
                     mt++sf++v++tfd++vL++lL+ecrell+ +++rhLt+ks+gr+++vfd++sd +fl+al++p ++++++l+k++d++nk+lde
  XP_006254771.1 101 MTVVSFHQVEYTFDRNVLSRLLNECRELLHDIIQRHLTAKSHGRVNNVFDHFSDCDFLAALYNPFGKFKPHLQKLCDGINKMLDE 185
                     ************************************************************************************8 PP



Or compare XP_006254771.1 to CDD or PaperBLAST